close

SimulationCraft 710-01

for World of Warcraft 7.1.0 Live (wow build level 22882, git build 375fc9d)

Current simulator hotfixes

Horrific Appendages

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-10-09 In-game testing shows that the actual rppm is much closer to 1.3~ than 0.7, so we slightly underestimated down to 1.25.
Horrific Appendages rppm 1.25 0.70

Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-10-10 Instincts of the mongoose effect increased from 10% to 20%
(effect#1) base_value 0.00 0.00 Verification Failure (10.00)

Mark of the Hidden Satyr

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-10-10 In-game testing shows that the damage from this ability is roughly 10% higher than what spelldata shows.
Mark of the Hidden Satyr (effect#1) average 29.13 26.49

Table of Contents

Raid Summary

 

Raid Event List
0 adds,count=5,first=20,cooldown=30,duration=20,last=300
1 movement,first=20,cooldown=30,distance=25,last=300
2 movement,players_only=1,first=12,cooldown=16,distance=8

Actions per Minute / DPS Variance Summary

DPS Scale Factors (dps increase per unit stat)

Profile Str Agi Int Crit Haste Mastery Vers wowhead
Illistan - 16.03 - 9.83 7.56 9.07 11.13 wowhead
Mortwraith - 18.63 - 10.49 0.78 8.63 12.48 wowhead
Táunks - 15.94 - 9.91 9.21 6.60 11.35 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Buuey - - 8.30 6.99 8.62 4.08 7.31 wowhead
Oinkie - 9.27 - 6.00 5.21 3.97 6.41 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Rothlandra - 11.30 - 9.26 7.78 12.23 9.95 wowhead
Sarkul - 13.59 - 10.67 12.39 11.98 11.04 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Zipi 12.26 - - 10.55 7.73 5.72 10.67 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Faelik - - 12.65 12.85 14.17 12.07 10.02 wowhead
Raji - - 10.72 9.25 9.52 8.03 8.84 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Vait - 13.43 - 8.09 7.43 5.49 9.16 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Bowflexn - 15.25 - 10.82 12.42 15.05 11.59 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Alacastria 12.16 - - 8.85 11.56 11.68 9.83 wowhead
Illistan

Illistan : 482841 dps, 229743 dps to main target

  • Race: Blood Elf
  • Class: Demonhunter
  • Spec: Havoc
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
482840.6 482840.6 679.2 / 0.141% 123783.0 / 25.6% 39658.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.1 12.1 Fury 2.04% 58.0 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Illistan/advanced
Talents
  • 15: Fel Mastery (Havoc Demon Hunter)
  • 30: Demonic Appetite (Havoc Demon Hunter)
  • 45: Bloodlet (Havoc Demon Hunter)
  • 60: Soul Rending (Havoc Demon Hunter)
  • 75: Nemesis (Havoc Demon Hunter)
  • 90: Master of the Glaive (Havoc Demon Hunter)
  • 100: Chaos Blades (Havoc Demon Hunter)
  • Talent Calculator
Artifact
Professions
  • herbalism: 336
  • enchanting: 54
Scale Factors for Illistan Damage Per Second
Agi Vers Crit Mastery Haste
Scale Factors 16.03 11.13 9.83 9.07 7.56
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.86 0.86 0.85 0.85 0.85
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit ~= Mastery > Haste
Pawn string ( Pawn: v1: "Illistan": Agility=16.03, CritRating=9.83, HasteRating=7.56, MasteryRating=9.07, Versatility=11.13 )

Scale Factors for other metrics

Scale Factors for Illistan Damage Per Second
Agi Vers Crit Mastery Haste
Scale Factors 16.03 11.13 9.83 9.07 7.56
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.86 0.86 0.85 0.85 0.85
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit ~= Mastery > Haste
Pawn string ( Pawn: v1: "Illistan": Agility=16.03, CritRating=9.83, HasteRating=7.56, MasteryRating=9.07, Versatility=11.13 )
Scale Factors for Illistan Priority Target Damage Per Second
Agi Crit Vers Haste Mastery
Scale Factors 7.02 5.23 5.21 4.91 4.55
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.17 0.17 0.17 0.17 0.17
Gear Ranking
Optimizers
Ranking
  • Agi > Crit ~= Vers > Haste > Mastery
Pawn string ( Pawn: v1: "Illistan": Agility=7.02, CritRating=5.23, HasteRating=4.91, MasteryRating=4.55, Versatility=5.21 )
Scale Factors for Illistan Damage Per Second (Effective)
Agi Vers Crit Mastery Haste
Scale Factors 16.03 11.13 9.83 9.07 7.56
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Mastery > Haste
Pawn string ( Pawn: v1: "Illistan": Agility=16.03, CritRating=9.83, HasteRating=7.56, MasteryRating=9.07, Versatility=11.13 )
Scale Factors for Illistan Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Illistan": )
Scale Factors for Illistan Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Illistan": )
Scale Factors for Illistan Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Illistan": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Illistan": )
Scale Factors for Illistan Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Illistan": )
Scale Factors for Illistan Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Illistan": )
Scale Factors for Illistan Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Illistan": )
Scale Factors for Illistan Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Illistan": )
Scale Factors for IllistanTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Illistan": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Illistan 482841
Annihilation 13921 3.0% 13.2 15.02sec 430810 455830 Direct 26.4 139413 320408 215488 42.0% 0.0%  

Stats details: annihilation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.22 26.43 0.00 0.00 0.9451 0.0000 5696047.70 5696047.70 0.00 455829.68 455829.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.32 57.97% 139412.69 99524 177849 142842.61 121972 160163 2136195 2136195 0.00
crit 11.11 42.03% 320408.41 228905 409052 324221.63 0 368376 3559853 3559853 0.00
 
 

Action details: annihilation

Static Values
  • id:201427
  • school:chaos
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
Spelldata
  • id:201427
  • name:Annihilation
  • school:chaos
  • tooltip:
  • description:Slice your target for ${$227518sw1+$201428sw1} Chaos damage. Critical strikes refund {$197125s1=20} Fury.
 
auto_attack_mh 7210 1.5% 119.0 3.38sec 24313 11183 Direct 119.0 19783 39570 24313 41.9% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.03 119.03 0.00 0.00 2.1741 0.0000 2893985.75 4254433.18 31.98 11183.23 11183.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.60 39.15% 19782.84 18326 21992 19810.55 18961 21129 921907 1355291 31.98
crit 49.84 41.87% 39569.63 36653 43983 39626.11 37898 41889 1972079 2899142 31.98
miss 22.59 18.98% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 3608 0.8% 119.0 3.38sec 12168 5598 Direct 119.0 9891 19785 12168 41.9% 18.9%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.03 119.03 0.00 0.00 2.1737 0.0000 1448324.24 2129173.82 31.98 5597.65 5597.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.58 39.14% 9891.34 9163 10996 9905.73 9373 10597 460771 677377 31.98
crit 49.91 41.93% 19784.81 18326 21992 19813.55 18923 20931 987553 1451797 31.98
miss 22.53 18.93% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Blade Dance 51564 10.6% 19.5 14.59sec 1045600 766416 Direct 455.1 31558 63167 44772 41.8% 0.0%  

Stats details: blade_dance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.49 455.07 0.00 0.00 1.3643 0.0000 20374410.15 29952312.84 31.98 766416.27 766416.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 264.83 58.19% 31557.84 17060 83941 31558.17 28823 34525 8357372 12286129 31.98
crit 190.24 41.81% 63166.66 34121 167882 63166.18 55190 73403 12017038 17666184 31.98
 
 

Action details: blade_dance

Static Values
  • id:188499
  • school:physical
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.blade_dance
Spelldata
  • id:188499
  • name:Blade Dance
  • school:physical
  • tooltip:Dodge chance increased by {$s2=100}%.
  • description:Strike all nearby enemies for ${$sw2+2*$199552sw2+$200685sw2} Physical damage, and increase your chance to dodge by {$s2=100}% for {$d=1 second}.
 
Chaos Blades (chaos_blade_mh) 7906 1.6% 17.2 21.84sec 182975 114011 Direct 17.2 128925 257785 182972 41.9% 0.0%  

Stats details: chaos_blade_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.23 17.23 0.00 0.00 1.6049 0.0000 3153557.66 3153557.66 0.00 114011.48 114011.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.01 58.06% 128924.70 115034 138041 128989.13 115034 138041 1289998 1289998 0.00
crit 7.23 41.94% 257784.54 230068 276081 257879.18 0 276081 1863559 1863559 0.00
 
 

Action details: chaos_blade_mh

Static Values
  • id:211796
  • school:chaos
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:211796
  • name:Chaos Blades
  • school:chaos
  • tooltip:
  • description:Attack with pure Fel power, dealing Chaos damage equal to {$s1=3}% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.00
 
Chaos Blades (chaos_blade_oh) 3952 0.8% 17.2 21.84sec 91473 56997 Direct 17.2 64447 128935 91474 41.9% 0.0%  

Stats details: chaos_blade_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.23 17.23 0.00 0.00 1.6049 0.0000 1576537.23 1576537.23 0.00 56997.01 56997.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.01 58.09% 64446.75 57517 69020 64474.44 57517 69020 645241 645241 0.00
crit 7.22 41.91% 128935.49 115034 138041 128925.48 0 138041 931296 931296 0.00
 
 

Action details: chaos_blade_oh

Static Values
  • id:211797
  • school:chaos
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:211797
  • name:Chaos Blades
  • school:chaos
  • tooltip:
  • description:Attack with pure Fel power, dealing Chaos damage equal to {$s1=3}% off-hand weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.00
 
Chaos Strike 57700 12.0% 79.9 4.60sec 289506 211200 Direct 159.7 93774 215639 144834 41.9% 0.0%  

Stats details: chaos_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.88 159.68 0.00 0.00 1.3708 0.0000 23127059.73 23127059.73 0.00 211200.24 211200.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 92.78 58.10% 93773.88 76557 136998 93913.83 89173 99579 8700083 8700083 0.00
crit 66.90 41.90% 215638.82 176080 315096 215966.46 202335 237246 14426977 14426977 0.00
 
 

Action details: chaos_strike

Static Values
  • id:162794
  • school:chaos
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
Spelldata
  • id:162794
  • name:Chaos Strike
  • school:chaos
  • tooltip:
  • description:Slice your target for ${$222031sw1+$199547sw1} Chaos damage. Critical strikes refund {$197125s1=20} Fury.
 
Death Sweep 7031 1.4% 2.0 5.70sec 1384517 1614761 Direct 44.6 43942 87786 62271 41.8% 0.0%  

Stats details: death_sweep

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.01 44.63 0.00 0.00 0.8576 0.0000 2779003.29 4085398.07 31.98 1614760.77 1614760.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.97 58.20% 43941.94 29114 104809 43718.82 29477 59240 1141242 1677734 31.98
crit 18.66 41.80% 87786.22 58227 209618 87359.75 58227 130595 1637761 2407664 31.98
 
 

Action details: death_sweep

Static Values
  • id:210152
  • school:physical
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.blade_dance
Spelldata
  • id:210152
  • name:Death Sweep
  • school:physical
  • tooltip:Dodge chance increased by {$s3=0}%.
  • description:Strike all nearby enemies for ${3*$210153sw2+$210155sw2} Physical damage, and increase your Dodge chance by {$s2=100}% for {$d=1 second}.
 
Demon's Bite 20737 4.3% 104.5 3.81sec 79481 61101 Direct 104.5 56025 112062 79481 41.9% 0.0%  

Stats details: demons_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 104.47 104.47 0.00 0.00 1.3008 0.0000 8303025.77 12206234.37 31.98 61101.08 61101.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.74 58.14% 56025.41 50242 71927 56100.72 53393 59795 3402921 5002616 31.98
crit 43.73 41.86% 112061.71 100484 143853 112209.69 105058 121796 4900105 7203618 31.98
 
 

Action details: demons_bite

Static Values
  • id:162243
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<gcd&fury.deficit>=20
Spelldata
  • id:162243
  • name:Demon's Bite
  • school:physical
  • tooltip:
  • description:Quickly attack for $sw2 Physical damage. |cFFFFFFFFGenerates $m3 to $M3 Fury.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.60
 
Eye Beam 35647 (51012) 7.4% (10.5%) 7.3 55.44sec 2765746 1432955 Periodic 307.2 0 45984 45984 100.0% 0.0% 2.9%

Stats details: eye_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.31 0.00 67.73 307.16 1.9302 0.1738 14124671.97 14124671.97 0.00 1432954.99 1432954.99
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 307.2 100.00% 45984.50 42747 61197 45964.65 43380 50333 14124672 14124672 0.00
 
 

Action details: eye_beam

Static Values
  • id:198013
  • school:chaos
  • resource:fury
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
Spelldata
  • id:198013
  • name:Eye Beam
  • school:chromatic
  • tooltip:
  • description:Blasts all enemies directly in front of you for $<dmg> Chaos damage. Eye Beam always critically strikes.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:2.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Anguish 15365 3.2% 0.0 0.00sec 0 0 Direct 31.8 134682 269701 191250 41.9% 0.0%  

Stats details: anguish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 31.84 0.00 0.00 0.0000 0.0000 6088591.12 6088591.12 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.50 58.10% 134682.20 13172 188574 134699.38 83669 163483 2491337 2491337 0.00
crit 13.34 41.90% 269701.07 26344 377148 269650.91 122364 335945 3597254 3597254 0.00
 
 

Action details: anguish

Static Values
  • id:202446
  • school:chaos
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202446
  • name:Anguish
  • school:chaos
  • tooltip:
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals {$202446s1=10} Chaos damage to the victim per application.}
 
Fel Rush 84276 17.4% 40.6 9.93sec 822400 2035742 Direct 168.6 139613 279233 198164 41.9% 0.0%  

Stats details: fel_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.62 168.59 0.00 0.00 0.4040 0.0000 33408565.11 33408565.11 0.00 2035742.19 2035742.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 97.89 58.06% 139612.78 125861 180182 139625.98 134444 146056 13666704 13666704 0.00
crit 70.70 41.94% 279232.99 251722 360365 279261.10 268665 294103 19741861 19741861 0.00
 
 

Action details: fel_rush

Static Values
  • id:195072
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.2500
  • min_gcd:0.2500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time=0
Spelldata
  • id:195072
  • name:Fel Rush
  • school:physical
  • tooltip:
  • description:Rush forward, incinerating anything in your path for {$192611s1=0} Chaos damage.$?a192939[ |cFFFFFFFFGenerates {$192939s1=25} Fury if you damage an enemy.|r][]
 
Fury of the Illidari 43592 (69731) 9.0% (14.4%) 7.1 60.54sec 3904734 3004334 Periodic 447.6 27195 54383 38586 41.9% 0.0% 5.3%

Stats details: fury_of_the_illidari

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.07 0.00 49.36 447.57 1.2998 0.4283 17269757.32 17269757.32 0.00 910599.31 3004334.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 260.1 58.10% 27195.05 16945 48518 27196.50 25724 29240 7072115 7072115 0.00
crit 187.5 41.90% 54382.85 33891 97036 54385.92 49915 60056 10197642 10197642 0.00
 
 

Action details: fury_of_the_illidari

Static Values
  • id:201467
  • school:chaos
  • resource:none
  • range:5.0
  • travel_speed:3.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
Spelldata
  • id:201467
  • name:Fury of the Illidari
  • school:physical
  • tooltip:
  • description:Throws the |cFFFFCC99Twinblades of the Deceiver|r in a whirlwind of energy, causing ${7*($201628sw1+$201789sw1)} Chaos damage over {$d=3 seconds} to all nearby enemies.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Rage of the Illidari 26138 5.4% 7.0 60.54sec 1473237 0 Direct 31.7 326583 0 326583 0.0% 0.0%  

Stats details: rage_of_the_illidari

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.03 31.71 0.00 0.00 0.0000 0.0000 10355093.81 10355093.81 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.71 100.00% 326583.32 213512 2171179 327903.30 301933 744942 10355094 10355094 0.00
 
 

Action details: rage_of_the_illidari

Static Values
  • id:217070
  • school:chaos
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:217070
  • name:Rage of the Illidari
  • school:chaos
  • tooltip:
  • description:{$@spelldesc201472=When Fury of the Illidari ends, {$s1=60}% of the damage it dealt erupts in an explosion of fel energy, dividing that Chaos damage among all neaby enemies.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:294849.33
  • base_dd_max:294849.33
 
Metamorphosis (_impact) 323 0.1% 1.4 0.00sec 93342 0 Direct 1.4 65861 131722 93344 41.7% 0.0%  

Stats details: metamorphosis_impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.41 1.41 0.00 0.00 0.0000 0.0000 131597.25 131597.25 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.82 58.27% 65861.20 65861 65861 44809.86 0 65861 54110 54110 0.00
crit 0.59 41.73% 131722.40 131722 131722 68080.95 0 131722 77487 77487 0.00
 
 

Action details: metamorphosis_impact

Static Values
  • id:200166
  • school:chaos
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:200166
  • name:Metamorphosis
  • school:chromatic
  • tooltip:Stunned.
  • description:{$@spelldesc191427=Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.}
 
Potion of the Old War 11667 2.4% 24.0 16.66sec 192649 0 Direct 24.0 135776 271684 192650 41.8% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.02 24.02 0.00 0.00 0.0000 0.0000 4627881.22 6803423.75 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.97 58.15% 135776.15 125186 179217 135698.68 125186 154618 1896751 2788404 31.98
crit 10.05 41.85% 271684.47 250373 358433 271552.64 250373 307808 2731130 4015020 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Throw Glaive 41073 (92134) 8.5% (19.1%) 47.6 8.47sec 768936 595020 Direct 107.7 106747 213530 151541 41.9% 0.0%  

Stats details: throw_glaive

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.65 107.71 0.00 0.00 1.2923 0.0000 16321866.80 23994690.25 31.98 595020.23 595020.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.53 58.05% 106746.80 97223 139185 106767.16 102268 111973 6674346 9811920 31.98
crit 45.18 41.95% 213530.17 194447 278370 213571.94 202598 228481 9647521 14182770 31.98
 
 

Action details: throw_glaive

Static Values
  • id:185123
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
Spelldata
  • id:185123
  • name:Throw Glaive
  • school:physical
  • tooltip:
  • description:Throw a demonic glaive at the target, dealing $sw1 Physical damage. The glaive can ricochet to ${$x1-1} additional enemies within 10 yards.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.90
 
    Bloodlet 51061 10.6% 0.0 0.00sec 0 0 Periodic 357.2 56869 0 56869 0.0% 0.0% 178.2%

Stats details: bloodlet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 357.21 357.21 0.0000 2.0000 20314123.64 20314123.64 0.00 28434.43 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 357.2 100.00% 56868.99 29167 162383 56915.02 48323 67620 20314124 20314124 0.00
 
 

Action details: bloodlet

Static Values
  • id:207690
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207690
  • name:Bloodlet
  • school:physical
  • tooltip:Inflicts $w1 damage every $t1 sec.
  • description:{$@spelldesc206473=Throw Glaive causes targets to bleed for {$s1=150}% of the damage inflicted over {$207690d=10 seconds}. If this effect is reapplied, any remaining damage will be added to the new Bloodlet.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Vengeful Retreat 69 0.0% 0.2 80.27sec 155942 0 Direct 1.1 18283 36571 25990 42.1% 0.0%  

Stats details: vengeful_retreat

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.18 1.05 0.00 0.00 0.0000 0.0000 27370.58 40237.34 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.61 57.85% 18282.70 17253 20704 3045.58 0 20704 11139 16375 5.33
crit 0.44 42.15% 36570.57 34507 41408 5923.86 0 41408 16232 23862 5.18
 
 

Action details: vengeful_retreat

Static Values
  • id:198793
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:25.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
Spelldata
  • id:198793
  • name:Vengeful Retreat
  • school:physical
  • tooltip:
  • description:Remove all snares and vault away. Nearby enemies take $198813sw2 Physical damage and have their movement speed reduced by {$198813s1=70}% for {$198813d=3 seconds}.$?a203551[ |cFFFFFFFFGenerates $203650o1 Fury over {$203650d=5 seconds} if you damage an enemy.|r][]
 
Simple Action Stats Execute Interval
Illistan
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Illistan
  • harmful:false
  • if_expr:
 
Blur 0.2 125.22sec

Stats details: blur

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.16 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: blur

Static Values
  • id:198589
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
Spelldata
  • id:198589
  • name:Blur
  • school:physical
  • tooltip:
  • description:Increases your chance to dodge by {$212800s2=50}% and reduces all damage taken by {$212800s3=35}% for {$212800d=10 seconds}.
 
Chaos Blades 3.3 150.57sec

Stats details: chaos_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.31 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: chaos_blades

Static Values
  • id:211048
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.metamorphosis.up|cooldown.metamorphosis.remains>100|target.time_to_die<20
Spelldata
  • id:211048
  • name:Chaos Blades
  • school:physical
  • tooltip:Damage done increased by $w2%. Auto attack damage increased by {$s1=200}%, and deal Chaos damage.
  • description:Increases all damage done by {$185164s1=0}% (based on Mastery) for {$d=12 seconds}. While active, your auto attack deals {$s1=200}% increased damage, and causes Chaos damage.
 
Consume Soul (_lesser) 16.4 24.72sec

Stats details: consume_soul_lesser

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 16.42 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: consume_soul_lesser

Static Values
  • id:203794
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Illistan
  • harmful:false
  • if_expr:
Spelldata
  • id:203794
  • name:Consume Soul
  • school:shadow
  • tooltip:
  • description:Consume a Lesser Soul Fragment, healing you for {$s1=0} health.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Illistan
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Illistan
  • harmful:false
  • if_expr:
 
Metamorphosis 0.4 0.00sec

Stats details: metamorphosis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.41 0.00 0.00 0.00 1.2723 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: metamorphosis

Static Values
  • id:191427
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:240.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191427
  • name:Metamorphosis
  • school:physical
  • tooltip:
  • description:Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.
 
Nemesis 3.0 120.48sec

Stats details: nemesis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 1.2915 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: nemesis

Static Values
  • id:206491
  • school:physical
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:raid_event.adds.exists&debuff.nemesis.down&(active_enemies>desired_targets|raid_event.adds.in>60)
Spelldata
  • id:206491
  • name:Nemesis
  • school:physical
  • tooltip:Damage taken increased by {$s1=20}%.
  • description:Increases damage you inflict against the target by {$s1=20}% for {$d=60 seconds}. When the target is slain, you will inflict {$s1=20}% additional damage against all creature types matching the original target (Humanoid, Dragonkin, etc.) for the remaining duration.
 
pick_up_fragment 21.0 19.10sec

Stats details: pick_up_fragment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.01 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: pick_up_fragment

Static Values
  • id:0
  • school:none
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.demonic_appetite.enabled&fury.deficit>=30
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blade Dance 19.5 0.0 14.6sec 14.6sec 4.93% 4.93% 0.0(0.0) 19.5

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_blade_dance
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • blade_dance_1:4.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188499
  • name:Blade Dance
  • tooltip:Dodge chance increased by {$s2=100}%.
  • description:Strike all nearby enemies for ${$sw2+2*$199552sw2+$200685sw2} Physical damage, and increase your chance to dodge by {$s2=100}% for {$d=1 second}.
  • max_stacks:0
  • duration:1.00
  • cooldown:10.00
  • default_chance:0.00%
Blood Frenzy 14.2 8.7 28.4sec 17.2sec 45.37% 45.37% 8.7(8.7) 13.7

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2743.21

Stack Uptimes

  • blood_frenzy_1:45.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your ranged and melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.12% 11.24% 0.0(0.0) 1.0

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Blur 0.2 0.0 109.4sec 109.4sec 0.41% 0.41% 0.0(0.0) 0.2

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_blur
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.35

Stack Uptimes

  • blur_1:0.41%

Trigger Attempt Success

  • trigger_pct:15.97%

Spelldata details

  • id:212800
  • name:Blur
  • tooltip:Dodge increased by {$s2=50}%. All damage reduced by {$s3=35}%.
  • description:{$@spelldesc198589=Increases your chance to dodge by {$212800s2=50}% and reduces all damage taken by {$212800s3=35}% for {$212800d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:60.00
  • default_chance:0.00%
Chaos Blades 3.3 0.0 150.2sec 150.2sec 9.86% 12.48% 0.0(0.0) 3.2

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_chaos_blades
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • chaos_blades_1:9.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:211048
  • name:Chaos Blades
  • tooltip:Damage done increased by $w2%. Auto attack damage increased by {$s1=200}%, and deal Chaos damage.
  • description:Increases all damage done by {$185164s1=0}% (based on Mastery) for {$d=12 seconds}. While active, your auto attack deals {$s1=200}% increased damage, and causes Chaos damage.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Death Sweep 2.0 0.0 5.7sec 5.7sec 0.51% 0.51% 0.0(0.0) 2.0

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_death_sweep
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • death_sweep_1:0.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210152
  • name:Death Sweep
  • tooltip:Dodge chance increased by {$s3=0}%.
  • description:Strike all nearby enemies for ${3*$210153sw2+$210155sw2} Physical damage, and increase your Dodge chance by {$s2=100}% for {$d=1 second}.
  • max_stacks:0
  • duration:1.00
  • cooldown:8.00
  • default_chance:0.00%
fel_rush_movement 1.1 0.0 183.8sec 183.8sec 0.07% 0.07% 0.0(0.0) 1.1

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_fel_rush_movement
  • max_stacks:1
  • duration:0.25
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • fel_rush_movement_1:0.07%

Trigger Attempt Success

  • trigger_pct:75.10%
Metamorphosis 7.8 0.5 56.0sec 51.6sec 13.44% 13.01% 0.5(0.5) 7.6

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_metamorphosis
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • metamorphosis_1:13.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162264
  • name:Metamorphosis
  • tooltip:Chaos Strike and Blade Dance upgraded to $@spellname201427 and $@spellname210152. Haste increased by {$s7=25}%.
  • description:{$@spelldesc191427=Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Nemesis (_buff) 2.0 0.0 120.0sec 120.0sec 25.64% 25.64% 0.0(0.0) 2.0

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_nemesis_buff
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • nemesis_buff_1:25.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:208605
  • name:Nemesis
  • tooltip:Damage against Humanoids increased by {$s1=20}%.
  • description:Increases damage against Humanoids by {$s1=20}%.
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
out_of_range 0.9 0.9 155.2sec 35.3sec 0.15% 0.15% 0.9(0.9) 0.0

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_out_of_range
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • out_of_range_1:0.15%

Trigger Attempt Success

  • trigger_pct:66.30%
Potion of the Old War 2.0 0.0 361.0sec 0.0sec 12.12% 12.12% 0.0(0.0) 1.9

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Rage of the Illidari 7.1 440.5 60.5sec 0.8sec 5.28% 5.28% 440.5(440.5) 0.0

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_rage_of_the_illidari
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • rage_of_the_illidari_1:5.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:217060
  • name:Rage of the Illidari
  • tooltip:
  • description:{$@spelldesc201472=When Fury of the Illidari ends, {$s1=60}% of the damage it dealt erupts in an explosion of fel energy, dividing that Chaos damage among all neaby enemies.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 11.51% 11.51% 2.0(2.0) 0.0

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:11.51%

Trigger Attempt Success

  • trigger_pct:100.00%
vengeful_retreat_movement 0.2 0.0 83.6sec 83.6sec 0.04% 0.04% 0.0(0.0) 0.2

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_vengeful_retreat_movement
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vengeful_retreat_movement_1:0.04%

Trigger Attempt Success

  • trigger_pct:16.75%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Illistan
annihilation Fury 13.2 528.9 40.0 40.0 10769.9
blade_dance Fury 19.5 682.0 35.0 35.0 29874.3
chaos_strike Fury 79.9 3195.4 40.0 40.0 7237.7
death_sweep Fury 2.0 70.3 35.0 35.0 39557.7
eye_beam Fury 7.3 365.4 50.0 50.0 55314.3
Resource Gains Type Count Total Average Overflow
demonic_appetite_fury Fury 16.42 492.65 (10.10%) 30.00 0.01 0.00%
fel_rush_dmg Fury 40.62 997.01 (20.43%) 24.54 18.57 1.83%
annihilation Fury 5.55 111.06 (2.28%) 20.00 0.00 0.00%
demons_bite Fury 104.47 2610.20 (53.49%) 24.99 1.51 0.06%
chaos_strike Fury 33.43 668.54 (13.70%) 20.00 0.11 0.02%
Resource RPS-Gain RPS-Loss
Fury 12.17 12.07
Combat End Resource Mean Min Max
Fury 37.97 0.00 99.00

Benefits & Uptimes

Benefits %
Uptimes %
Fury Cap 0.9%

Procs

Count Interval
delayed_swing__channeling 8.7 85.0sec
soul_fragment_lesser 16.6 24.6sec
demonic_appetite 16.6 24.6sec
demons_bite_in_meta 16.2 16.7sec

Statistics & Data Analysis

Fight Length
Sample Data Illistan Fight Length
Count 9999
Mean 401.00
Minimum 308.02
Maximum 501.87
Spread ( max - min ) 193.85
Range [ ( max - min ) / 2 * 100% ] 24.17%
DPS
Sample Data Illistan Damage Per Second
Count 9999
Mean 482840.58
Minimum 408755.56
Maximum 581498.37
Spread ( max - min ) 172742.81
Range [ ( max - min ) / 2 * 100% ] 17.89%
Standard Deviation 34653.2744
5th Percentile 433720.35
95th Percentile 544922.35
( 95th Percentile - 5th Percentile ) 111202.00
Mean Distribution
Standard Deviation 346.5501
95.00% Confidence Intervall ( 482161.35 - 483519.80 )
Normalized 95.00% Confidence Intervall ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 197
0.1% Error 19786
0.1 Scale Factor Error with Delta=300 10251141
0.05 Scale Factor Error with Delta=300 41004565
0.01 Scale Factor Error with Delta=300 1025114136
Priority Target DPS
Sample Data Illistan Priority Target Damage Per Second
Count 9999
Mean 229743.14
Minimum 204481.32
Maximum 258469.33
Spread ( max - min ) 53988.01
Range [ ( max - min ) / 2 * 100% ] 11.75%
Standard Deviation 6777.4527
5th Percentile 218970.04
95th Percentile 241169.07
( 95th Percentile - 5th Percentile ) 22199.04
Mean Distribution
Standard Deviation 67.7779
95.00% Confidence Intervall ( 229610.29 - 229875.98 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 33
0.1% Error 3343
0.1 Scale Factor Error with Delta=300 392117
0.05 Scale Factor Error with Delta=300 1568471
0.01 Scale Factor Error with Delta=300 39211789
DPS(e)
Sample Data Illistan Damage Per Second (Effective)
Count 9999
Mean 482840.58
Minimum 408755.56
Maximum 581498.37
Spread ( max - min ) 172742.81
Range [ ( max - min ) / 2 * 100% ] 17.89%
Damage
Sample Data Illistan Damage
Count 9999
Mean 192021470.34
Minimum 166536308.64
Maximum 218466280.27
Spread ( max - min ) 51929971.62
Range [ ( max - min ) / 2 * 100% ] 13.52%
DTPS
Sample Data Illistan Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Illistan Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Illistan Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Illistan Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Illistan Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Illistan Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data IllistanTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Illistan Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=old_war
5 0.00 metamorphosis
Default action list Executed every time the actor is available.
# count action,conditions
6 37.02 auto_attack
0.00 variable,name=pooling_for_meta,value=cooldown.metamorphosis.ready&buff.metamorphosis.down&(!talent.demonic.enabled|!cooldown.eye_beam.ready)&(!talent.chaos_blades.enabled|cooldown.chaos_blades.ready)&(!talent.nemesis.enabled|debuff.nemesis.up|cooldown.nemesis.ready)
"Getting ready to use meta" conditions, this is used in a few places.
0.00 variable,name=blade_dance,value=talent.first_blood.enabled|spell_targets.blade_dance1>=2+talent.chaos_cleave.enabled
Blade Dance conditions. Always if First Blood is talented, otherwise 3+ targets with Chaos Cleave or 2+ targets without.
0.00 variable,name=pooling_for_blade_dance,value=variable.blade_dance&fury-40<35-talent.first_blood.enabled*20&spell_targets.blade_dance1>=2
Blade Dance pooling condition, so we don't spend too much fury when we need it soon. No need to pool on # single target since First Blood already makes it cheap enough and delaying it a tiny bit isn't a big deal.
7 0.16 blur,if=artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
8 0.00 call_action_list,name=cooldown
0.00 fel_rush,animation_cancel=1,if=time=0
Fel Rush in at the start of combat.
9 21.01 pick_up_fragment,if=talent.demonic_appetite.enabled&fury.deficit>=30
0.00 consume_magic
0.00 vengeful_retreat,if=(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
Vengeful Retreat backwards through the target to minimize downtime.
A 35.91 fel_rush,animation_cancel=1,if=(talent.momentum.enabled|talent.fel_mastery.enabled)&(!talent.momentum.enabled|(charges=2|cooldown.vengeful_retreat.remains>4)&buff.momentum.down)&(!talent.fel_mastery.enabled|fury.deficit>=25)&(charges=2|(raid_event.movement.in>10&raid_event.adds.in>10))
Fel Rush for Momentum and for fury from Fel Mastery.
0.00 fel_barrage,if=charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Use Fel Barrage at max charges, saving it for Momentum and adds if possible.
B 3.86 throw_glaive,if=talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
C 7.08 fury_of_the_illidari,if=active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
0.00 eye_beam,if=talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
D 2.01 death_sweep,if=variable.blade_dance
E 19.52 blade_dance,if=variable.blade_dance
F 29.24 throw_glaive,if=talent.bloodlet.enabled&spell_targets>=2+talent.chaos_cleave.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&(spell_targets>=3|raid_event.adds.in>recharge_time+cooldown)
0.00 fel_eruption
0.00 felblade,if=fury.deficit>=30+buff.prepared.up*8
G 13.22 annihilation,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
H 11.29 throw_glaive,if=talent.bloodlet.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&raid_event.adds.in>recharge_time+cooldown
I 7.31 eye_beam,if=!talent.demonic.enabled&((spell_targets.eye_beam_tick>desired_targets&active_enemies>1)|(raid_event.adds.in>45&!variable.pooling_for_meta&buff.metamorphosis.down&(artifact.anguish_of_the_deceiver.enabled|active_enemies>1)))
0.00 demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<gcd&fury.deficit>=20
If Demonic is talented, pool fury as Eye Beam is coming off cooldown.
0.00 demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<2*gcd&fury.deficit>=45
0.00 throw_glaive,if=buff.metamorphosis.down&spell_targets>=2
J 79.88 chaos_strike,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
0.00 fel_barrage,if=charges=4&buff.metamorphosis.down&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Use Fel Barrage if its nearing max charges, saving it for Momentum and adds if possible.
K 3.60 fel_rush,animation_cancel=1,if=!talent.momentum.enabled&raid_event.movement.in>charges*10
L 104.47 demons_bite
M 3.30 throw_glaive,if=buff.out_of_range.up|buff.raid_movement.up
0.00 felblade,if=movement.distance|buff.out_of_range.up
N 1.11 fel_rush,if=movement.distance>15|(buff.out_of_range.up&!talent.momentum.enabled)
O 0.18 vengeful_retreat,if=movement.distance>15
actions.cooldown
# count action,conditions
P 3.00 nemesis,target_if=min:target.time_to_die,if=raid_event.adds.exists&debuff.nemesis.down&(active_enemies>desired_targets|raid_event.adds.in>60)
0.00 nemesis,if=!raid_event.adds.exists&(cooldown.metamorphosis.remains>100|target.time_to_die<70)
0.00 nemesis,sync=metamorphosis,if=!raid_event.adds.exists
Q 3.31 chaos_blades,if=buff.metamorphosis.up|cooldown.metamorphosis.remains>100|target.time_to_die<20
R 0.41 metamorphosis,if=variable.pooling_for_meta&fury.deficit<30&(talent.chaos_blades.enabled|!cooldown.fury_of_the_illidari.ready)
S 1.00 potion,name=old_war,if=buff.metamorphosis.remains>25|target.time_to_die<30

Sample Sequence

012456PQABCHLGLG9LGGGAGM6LGLGLLGBLFA6DLFI6LDA6LFLEAJLFLJ9ELJJLM6JLJFA6ELLLJF6JACAELJFJ9LJL6JLJAF6ELLFI6LA6EALJFLJLJ9LJJM6LAA6EFLJLJPQEC6AFLLJJ9JLJLJL6AEABFILLEFLLA6J9LE9JJLJLJLB6AEAFLJ9LJFECLLK6JJLJ9LJLJBFA6EA6LI6LFLELLJFL6J9JAJJLLJF6LAEAF6LJPLJCEFLJ69LAJ9LJJF6LEAFLA6ILFELLLJ9JJLM6AJJLF6LELALFK6J9LE9CJFLJLLIQAH6AJLJLJ9LHJJLA6JLHAJJJ9LJHLJA6JLJLHLJLLIAH6CAJ9LJJSHLJJLA6JHLJ9KJLJHLJL

Sample Sequence Table

time name target resources buffs
Pre flask Illistan 0.0/100: 0% fury
Pre food Illistan 0.0/100: 0% fury
Pre augmentation Illistan 0.0/100: 0% fury
Pre potion Fluffy_Pillow 0.0/100: 0% fury potion_of_the_old_war
0:00.000 metamorphosis Fluffy_Pillow 0.0/100: 0% fury metamorphosis, potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 0.0/100: 0% fury metamorphosis, potion_of_the_old_war
0:00.000 nemesis Fluffy_Pillow 0.0/100: 0% fury metamorphosis, potion_of_the_old_war
0:01.111 chaos_blades Fluffy_Pillow 0.0/100: 0% fury bloodlust, metamorphosis, potion_of_the_old_war
0:01.111 fel_rush Fluffy_Pillow 0.0/100: 0% fury bloodlust, metamorphosis, chaos_blades, potion_of_the_old_war
0:01.471 throw_glaive Fluffy_Pillow 25.0/100: 25% fury bloodlust, metamorphosis, chaos_blades, potion_of_the_old_war
0:02.352 fury_of_the_illidari Fluffy_Pillow 25.0/100: 25% fury bloodlust, metamorphosis, chaos_blades, potion_of_the_old_war
0:03.234 throw_glaive Fluffy_Pillow 25.0/100: 25% fury bloodlust, metamorphosis, chaos_blades, rage_of_the_illidari, potion_of_the_old_war
0:04.117 demons_bite Fluffy_Pillow 25.0/100: 25% fury bloodlust, metamorphosis, chaos_blades, rage_of_the_illidari, potion_of_the_old_war
0:05.000 annihilation Fluffy_Pillow 48.0/100: 48% fury bloodlust, metamorphosis, chaos_blades, rage_of_the_illidari, potion_of_the_old_war
0:05.884 demons_bite Fluffy_Pillow 28.0/100: 28% fury bloodlust, metamorphosis, chaos_blades, potion_of_the_old_war
0:06.766 annihilation Fluffy_Pillow 54.0/100: 54% fury bloodlust, metamorphosis, chaos_blades, potion_of_the_old_war
0:07.646 pick_up_fragment Fluffy_Pillow 34.0/100: 34% fury bloodlust, metamorphosis, chaos_blades, potion_of_the_old_war
0:07.646 demons_bite Fluffy_Pillow 34.0/100: 34% fury bloodlust, metamorphosis, chaos_blades, potion_of_the_old_war
0:08.529 annihilation Fluffy_Pillow 60.0/100: 60% fury bloodlust, metamorphosis, chaos_blades, potion_of_the_old_war
0:09.411 annihilation Fluffy_Pillow 70.0/100: 70% fury bloodlust, metamorphosis, chaos_blades, potion_of_the_old_war
0:10.293 annihilation Fluffy_Pillow 50.0/100: 50% fury bloodlust, metamorphosis, chaos_blades, potion_of_the_old_war
0:11.176 fel_rush Fluffy_Pillow 30.0/100: 30% fury bloodlust, metamorphosis, chaos_blades, potion_of_the_old_war
0:11.547 annihilation Fluffy_Pillow 55.0/100: 55% fury bloodlust, metamorphosis, chaos_blades, potion_of_the_old_war
0:12.428 throw_glaive Fluffy_Pillow 35.0/100: 35% fury bloodlust, raid_movement, metamorphosis, chaos_blades, potion_of_the_old_war
0:13.309 auto_attack Fluffy_Pillow 35.0/100: 35% fury bloodlust, metamorphosis, potion_of_the_old_war
0:13.309 demons_bite Fluffy_Pillow 35.0/100: 35% fury bloodlust, metamorphosis, potion_of_the_old_war
0:14.191 annihilation Fluffy_Pillow 59.0/100: 59% fury bloodlust, metamorphosis, potion_of_the_old_war
0:15.074 demons_bite Fluffy_Pillow 19.0/100: 19% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:15.892 annihilation Fluffy_Pillow 41.0/100: 41% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:16.708 demons_bite Fluffy_Pillow 1.0/100: 1% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:17.525 demons_bite Fluffy_Pillow 27.0/100: 27% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:18.340 annihilation Fluffy_Pillow 50.0/100: 50% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:19.156 throw_glaive Fluffy_Pillow 30.0/100: 30% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:19.974 demons_bite Fluffy_Pillow 30.0/100: 30% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:20.791 throw_glaive Fluffy_Pillow 59.0/100: 59% fury bloodlust, raid_movement, metamorphosis, blood_frenzy, potion_of_the_old_war
0:21.609 fel_rush Fluffy_Pillow 59.0/100: 59% fury bloodlust, raid_movement, metamorphosis, blood_frenzy, potion_of_the_old_war
0:21.969 Waiting 1.100 sec 84.0/100: 84% fury bloodlust, raid_movement, metamorphosis, blood_frenzy, potion_of_the_old_war
0:23.069 auto_attack Fluffy_Pillow 84.0/100: 84% fury bloodlust, metamorphosis, blood_frenzy
0:23.069 death_sweep Fluffy_Pillow 84.0/100: 84% fury bloodlust, metamorphosis, blood_frenzy
0:23.884 demons_bite Fluffy_Pillow 49.0/100: 49% fury bloodlust, metamorphosis, death_sweep, blood_frenzy
0:24.700 throw_glaive Fluffy_Pillow 71.0/100: 71% fury bloodlust, metamorphosis, blood_frenzy
0:25.519 eye_beam Fluffy_Pillow 71.0/100: 71% fury bloodlust, metamorphosis, blood_frenzy
0:26.826 auto_attack Fluffy_Pillow 21.0/100: 21% fury bloodlust, metamorphosis, blood_frenzy
0:26.826 demons_bite Fluffy_Pillow 21.0/100: 21% fury bloodlust, metamorphosis, blood_frenzy
0:27.642 death_sweep Fluffy_Pillow 50.0/100: 50% fury bloodlust, metamorphosis, blood_frenzy
0:28.460 fel_rush Fluffy_Pillow 15.0/100: 15% fury bloodlust, raid_movement, metamorphosis, death_sweep, blood_frenzy
0:28.824 Waiting 0.200 sec 40.0/100: 40% fury bloodlust, raid_movement, metamorphosis, blood_frenzy
0:29.024 auto_attack Fluffy_Pillow 40.0/100: 40% fury bloodlust, metamorphosis, blood_frenzy
0:29.024 demons_bite Fluffy_Pillow 40.0/100: 40% fury bloodlust, metamorphosis, blood_frenzy
0:29.841 throw_glaive Fluffy_Pillow 67.0/100: 67% fury bloodlust, metamorphosis, blood_frenzy
0:30.815 demons_bite Fluffy_Pillow 67.0/100: 67% fury bloodlust, blood_frenzy
0:31.834 blade_dance Fluffy_Pillow 91.0/100: 91% fury bloodlust, blood_frenzy
0:32.997 fel_rush Fluffy_Pillow 56.0/100: 56% fury bloodlust, blood_frenzy
0:33.461 chaos_strike Fluffy_Pillow 81.0/100: 81% fury bloodlust, blood_frenzy
0:34.480 demons_bite Fluffy_Pillow 41.0/100: 41% fury bloodlust, blood_frenzy
0:35.500 throw_glaive Fluffy_Pillow 67.0/100: 67% fury bloodlust, blood_frenzy
0:36.520 demons_bite Fluffy_Pillow 67.0/100: 67% fury bloodlust, blood_frenzy
0:37.542 chaos_strike Fluffy_Pillow 90.0/100: 90% fury bloodlust, blood_frenzy
0:38.562 pick_up_fragment Fluffy_Pillow 70.0/100: 70% fury bloodlust
0:38.562 blade_dance Fluffy_Pillow 70.0/100: 70% fury bloodlust
0:39.878 demons_bite Fluffy_Pillow 35.0/100: 35% fury bloodlust
0:40.980 chaos_strike Fluffy_Pillow 91.0/100: 91% fury bloodlust
0:42.082 chaos_strike Fluffy_Pillow 71.0/100: 71% fury
0:43.513 demons_bite Fluffy_Pillow 31.0/100: 31% fury
0:44.943 throw_glaive Fluffy_Pillow 54.0/100: 54% fury raid_movement
0:46.374 auto_attack Fluffy_Pillow 54.0/100: 54% fury
0:46.374 chaos_strike Fluffy_Pillow 54.0/100: 54% fury
0:47.806 demons_bite Fluffy_Pillow 34.0/100: 34% fury
0:49.237 chaos_strike Fluffy_Pillow 58.0/100: 58% fury
0:50.667 throw_glaive Fluffy_Pillow 38.0/100: 38% fury raid_movement, blood_frenzy
0:51.992 fel_rush Fluffy_Pillow 38.0/100: 38% fury raid_movement, blood_frenzy
0:52.354 Waiting 0.700 sec 63.0/100: 63% fury raid_movement, blood_frenzy
0:53.054 auto_attack Fluffy_Pillow 63.0/100: 63% fury blood_frenzy
0:53.054 blade_dance Fluffy_Pillow 63.0/100: 63% fury blood_frenzy
0:54.379 demons_bite Fluffy_Pillow 28.0/100: 28% fury blood_frenzy
0:55.703 demons_bite Fluffy_Pillow 53.0/100: 53% fury blood_frenzy
0:57.028 demons_bite Fluffy_Pillow 74.0/100: 74% fury blood_frenzy
0:58.352 chaos_strike Fluffy_Pillow 100.0/100: 100% fury blood_frenzy
0:59.677 throw_glaive Fluffy_Pillow 80.0/100: 80% fury
1:01.109 auto_attack Fluffy_Pillow 80.0/100: 80% fury
1:01.109 chaos_strike Fluffy_Pillow 80.0/100: 80% fury
1:02.542 fel_rush Fluffy_Pillow 40.0/100: 40% fury
1:02.921 fury_of_the_illidari Fluffy_Pillow 65.0/100: 65% fury
1:04.352 fel_rush Fluffy_Pillow 65.0/100: 65% fury rage_of_the_illidari
1:04.829 blade_dance Fluffy_Pillow 90.0/100: 90% fury rage_of_the_illidari
1:06.259 demons_bite Fluffy_Pillow 55.0/100: 55% fury
1:07.689 chaos_strike Fluffy_Pillow 81.0/100: 81% fury
1:09.120 throw_glaive Fluffy_Pillow 41.0/100: 41% fury
1:10.552 chaos_strike Fluffy_Pillow 41.0/100: 41% fury
1:11.984 pick_up_fragment Fluffy_Pillow 21.0/100: 21% fury
1:11.984 demons_bite Fluffy_Pillow 21.0/100: 21% fury
1:13.417 chaos_strike Fluffy_Pillow 78.0/100: 78% fury
1:14.851 demons_bite Fluffy_Pillow 38.0/100: 38% fury
1:16.282 Waiting 0.700 sec 61.0/100: 61% fury raid_movement
1:16.982 auto_attack Fluffy_Pillow 61.0/100: 61% fury
1:16.982 chaos_strike Fluffy_Pillow 61.0/100: 61% fury
1:18.414 demons_bite Fluffy_Pillow 21.0/100: 21% fury
1:19.846 chaos_strike Fluffy_Pillow 50.0/100: 50% fury
1:21.277 fel_rush Fluffy_Pillow 30.0/100: 30% fury raid_movement
1:21.700 throw_glaive Fluffy_Pillow 55.0/100: 55% fury raid_movement
1:23.131 auto_attack Fluffy_Pillow 55.0/100: 55% fury
1:23.131 blade_dance Fluffy_Pillow 55.0/100: 55% fury
1:24.564 demons_bite Fluffy_Pillow 20.0/100: 20% fury
1:25.996 demons_bite Fluffy_Pillow 48.0/100: 48% fury
1:27.426 throw_glaive Fluffy_Pillow 73.0/100: 73% fury
1:28.858 eye_beam Fluffy_Pillow 73.0/100: 73% fury
1:31.080 auto_attack Fluffy_Pillow 23.0/100: 23% fury
1:31.080 demons_bite Fluffy_Pillow 23.0/100: 23% fury
1:32.511 fel_rush Fluffy_Pillow 47.0/100: 47% fury raid_movement
1:32.856 Waiting 0.200 sec 72.0/100: 72% fury raid_movement
1:33.056 auto_attack Fluffy_Pillow 72.0/100: 72% fury
1:33.056 blade_dance Fluffy_Pillow 72.0/100: 72% fury
1:34.486 fel_rush Fluffy_Pillow 37.0/100: 37% fury
1:34.903 demons_bite Fluffy_Pillow 62.0/100: 62% fury
1:36.337 chaos_strike Fluffy_Pillow 89.0/100: 89% fury
1:37.767 throw_glaive Fluffy_Pillow 49.0/100: 49% fury blood_frenzy
1:39.093 demons_bite Fluffy_Pillow 49.0/100: 49% fury blood_frenzy
1:40.419 chaos_strike Fluffy_Pillow 70.0/100: 70% fury blood_frenzy
1:41.745 demons_bite Fluffy_Pillow 30.0/100: 30% fury blood_frenzy
1:43.071 chaos_strike Fluffy_Pillow 58.0/100: 58% fury blood_frenzy
1:44.396 pick_up_fragment Fluffy_Pillow 38.0/100: 38% fury blood_frenzy
1:44.396 demons_bite Fluffy_Pillow 38.0/100: 38% fury blood_frenzy
1:45.722 chaos_strike Fluffy_Pillow 58.0/100: 58% fury blood_frenzy
1:47.048 chaos_strike Fluffy_Pillow 48.0/100: 48% fury blood_frenzy
1:48.373 throw_glaive Fluffy_Pillow 28.0/100: 28% fury raid_movement, blood_frenzy
1:49.699 auto_attack Fluffy_Pillow 28.0/100: 28% fury blood_frenzy
1:49.699 demons_bite Fluffy_Pillow 28.0/100: 28% fury blood_frenzy
1:51.025 fel_rush Fluffy_Pillow 50.0/100: 50% fury raid_movement, blood_frenzy
1:51.411 Waiting 0.900 sec 75.0/100: 75% fury raid_movement, blood_frenzy
1:52.311 fel_rush Fluffy_Pillow 75.0/100: 75% fury raid_movement, blood_frenzy
1:52.949 Waiting 0.100 sec 100.0/100: 100% fury raid_movement, blood_frenzy
1:53.049 auto_attack Fluffy_Pillow 100.0/100: 100% fury blood_frenzy
1:53.049 blade_dance Fluffy_Pillow 100.0/100: 100% fury blood_frenzy
1:54.375 throw_glaive Fluffy_Pillow 65.0/100: 65% fury blood_frenzy
1:55.698 demons_bite Fluffy_Pillow 65.0/100: 65% fury blood_frenzy
1:57.023 chaos_strike Fluffy_Pillow 87.0/100: 87% fury blood_frenzy
1:58.350 demons_bite Fluffy_Pillow 67.0/100: 67% fury blood_frenzy
1:59.676 chaos_strike Fluffy_Pillow 94.0/100: 94% fury blood_frenzy
2:01.002 nemesis Fluffy_Pillow_Add1 54.0/100: 54% fury blood_frenzy
2:02.329 chaos_blades Fluffy_Pillow 54.0/100: 54% fury blood_frenzy
2:02.329 blade_dance Fluffy_Pillow 54.0/100: 54% fury chaos_blades, blood_frenzy
2:03.657 fury_of_the_illidari Fluffy_Pillow 19.0/100: 19% fury chaos_blades, blood_frenzy
2:04.983 auto_attack Fluffy_Pillow 19.0/100: 19% fury chaos_blades, rage_of_the_illidari, blood_frenzy
2:04.983 fel_rush Fluffy_Pillow 19.0/100: 19% fury chaos_blades, rage_of_the_illidari, blood_frenzy
2:05.398 throw_glaive Fluffy_Pillow 44.0/100: 44% fury chaos_blades, rage_of_the_illidari, blood_frenzy
2:06.723 demons_bite Fluffy_Pillow 44.0/100: 44% fury chaos_blades, blood_frenzy
2:08.050 demons_bite Fluffy_Pillow 71.0/100: 71% fury chaos_blades, blood_frenzy
2:09.376 chaos_strike Fluffy_Pillow 100.0/100: 100% fury chaos_blades
2:10.808 chaos_strike Fluffy_Pillow 80.0/100: 80% fury chaos_blades, nemesis_buff
2:12.242 pick_up_fragment Fluffy_Pillow 40.0/100: 40% fury chaos_blades, nemesis_buff
2:12.242 chaos_strike Fluffy_Pillow 40.0/100: 40% fury chaos_blades, nemesis_buff
2:13.674 demons_bite Fluffy_Pillow 30.0/100: 30% fury chaos_blades, nemesis_buff
2:15.106 chaos_strike Fluffy_Pillow 60.0/100: 60% fury nemesis_buff
2:16.539 demons_bite Fluffy_Pillow 20.0/100: 20% fury nemesis_buff
2:17.970 chaos_strike Fluffy_Pillow 48.0/100: 48% fury nemesis_buff
2:19.402 demons_bite Fluffy_Pillow 8.0/100: 8% fury nemesis_buff
2:20.834 auto_attack Fluffy_Pillow 37.0/100: 37% fury nemesis_buff
2:20.834 fel_rush Fluffy_Pillow 37.0/100: 37% fury nemesis_buff
2:21.266 blade_dance Fluffy_Pillow 62.0/100: 62% fury nemesis_buff, blood_frenzy
2:22.591 fel_rush Fluffy_Pillow 27.0/100: 27% fury nemesis_buff, blood_frenzy
2:23.105 throw_glaive Fluffy_Pillow 52.0/100: 52% fury nemesis_buff, blood_frenzy
2:24.432 throw_glaive Fluffy_Pillow 52.0/100: 52% fury nemesis_buff, blood_frenzy
2:25.757 eye_beam Fluffy_Pillow 52.0/100: 52% fury nemesis_buff, blood_frenzy
2:27.820 demons_bite Fluffy_Pillow 2.0/100: 2% fury nemesis_buff, blood_frenzy
2:29.145 demons_bite Fluffy_Pillow 28.0/100: 28% fury nemesis_buff, blood_frenzy
2:30.471 blade_dance Fluffy_Pillow 50.0/100: 50% fury nemesis_buff, blood_frenzy
2:31.798 throw_glaive Fluffy_Pillow 15.0/100: 15% fury nemesis_buff
2:33.430 demons_bite Fluffy_Pillow 15.0/100: 15% fury nemesis_buff
2:34.864 demons_bite Fluffy_Pillow 37.0/100: 37% fury nemesis_buff
2:36.296 fel_rush Fluffy_Pillow 64.0/100: 64% fury raid_movement, nemesis_buff
2:36.673 Waiting 0.300 sec 89.0/100: 89% fury raid_movement, nemesis_buff
2:36.973 auto_attack Fluffy_Pillow 89.0/100: 89% fury nemesis_buff
2:36.973 chaos_strike Fluffy_Pillow 89.0/100: 89% fury nemesis_buff
2:38.404 pick_up_fragment Fluffy_Pillow 49.0/100: 49% fury nemesis_buff
2:38.404 demons_bite Fluffy_Pillow 49.0/100: 49% fury nemesis_buff
2:39.836 blade_dance Fluffy_Pillow 77.0/100: 77% fury nemesis_buff
2:41.389 pick_up_fragment Fluffy_Pillow 42.0/100: 42% fury nemesis_buff
2:41.389 chaos_strike Fluffy_Pillow 42.0/100: 42% fury nemesis_buff
2:42.820 chaos_strike Fluffy_Pillow 52.0/100: 52% fury nemesis_buff
2:44.250 demons_bite Fluffy_Pillow 32.0/100: 32% fury nemesis_buff
2:45.683 chaos_strike Fluffy_Pillow 60.0/100: 60% fury nemesis_buff
2:47.116 demons_bite Fluffy_Pillow 20.0/100: 20% fury nemesis_buff
2:48.547 chaos_strike Fluffy_Pillow 40.0/100: 40% fury nemesis_buff
2:49.977 demons_bite Fluffy_Pillow 20.0/100: 20% fury nemesis_buff
2:51.407 throw_glaive Fluffy_Pillow 42.0/100: 42% fury raid_movement, nemesis_buff
2:52.840 auto_attack Fluffy_Pillow 42.0/100: 42% fury nemesis_buff
2:52.840 fel_rush Fluffy_Pillow 42.0/100: 42% fury nemesis_buff
2:53.206 blade_dance Fluffy_Pillow 67.0/100: 67% fury nemesis_buff, blood_frenzy
2:54.531 fel_rush Fluffy_Pillow 32.0/100: 32% fury nemesis_buff, blood_frenzy
2:54.970 throw_glaive Fluffy_Pillow 57.0/100: 57% fury nemesis_buff, blood_frenzy
2:56.296 demons_bite Fluffy_Pillow 57.0/100: 57% fury nemesis_buff, blood_frenzy
2:57.622 chaos_strike Fluffy_Pillow 80.0/100: 80% fury nemesis_buff, blood_frenzy
2:58.947 pick_up_fragment Fluffy_Pillow 60.0/100: 60% fury nemesis_buff, blood_frenzy
2:58.947 demons_bite Fluffy_Pillow 60.0/100: 60% fury nemesis_buff, blood_frenzy
3:00.273 chaos_strike Fluffy_Pillow 82.0/100: 82% fury nemesis_buff, blood_frenzy
3:01.600 throw_glaive Fluffy_Pillow 72.0/100: 72% fury blood_frenzy
3:02.925 blade_dance Fluffy_Pillow 72.0/100: 72% fury
3:04.356 fury_of_the_illidari Fluffy_Pillow 37.0/100: 37% fury
3:05.789 demons_bite Fluffy_Pillow 37.0/100: 37% fury rage_of_the_illidari
3:07.220 demons_bite Fluffy_Pillow 58.0/100: 58% fury rage_of_the_illidari
3:08.651 fel_rush Fluffy_Pillow 83.0/100: 83% fury raid_movement
3:09.046 auto_attack Fluffy_Pillow 100.0/100: 100% fury blood_frenzy
3:09.046 chaos_strike Fluffy_Pillow 100.0/100: 100% fury blood_frenzy
3:10.372 chaos_strike Fluffy_Pillow 60.0/100: 60% fury blood_frenzy
3:11.697 demons_bite Fluffy_Pillow 20.0/100: 20% fury blood_frenzy
3:13.024 chaos_strike Fluffy_Pillow 40.0/100: 40% fury blood_frenzy
3:14.349 pick_up_fragment Fluffy_Pillow 0.0/100: 0% fury blood_frenzy
3:14.349 demons_bite Fluffy_Pillow 0.0/100: 0% fury blood_frenzy
3:15.674 chaos_strike Fluffy_Pillow 54.0/100: 54% fury blood_frenzy
3:17.001 demons_bite Fluffy_Pillow 34.0/100: 34% fury blood_frenzy
3:18.325 chaos_strike Fluffy_Pillow 59.0/100: 59% fury blood_frenzy
3:19.652 throw_glaive Fluffy_Pillow 19.0/100: 19% fury
3:21.083 throw_glaive Fluffy_Pillow 19.0/100: 19% fury raid_movement
3:22.514 Waiting 0.400 sec 19.0/100: 19% fury raid_movement
3:22.914 fel_rush Fluffy_Pillow 19.0/100: 19% fury raid_movement
3:23.230 auto_attack Fluffy_Pillow 44.0/100: 44% fury blood_frenzy
3:23.230 blade_dance Fluffy_Pillow 44.0/100: 44% fury blood_frenzy
3:24.557 fel_rush Fluffy_Pillow 9.0/100: 9% fury raid_movement, blood_frenzy
3:25.016 auto_attack Fluffy_Pillow 34.0/100: 34% fury blood_frenzy
3:25.016 demons_bite Fluffy_Pillow 34.0/100: 34% fury blood_frenzy
3:26.341 eye_beam Fluffy_Pillow 59.0/100: 59% fury blood_frenzy
3:28.361 auto_attack Fluffy_Pillow 9.0/100: 9% fury blood_frenzy
3:28.361 demons_bite Fluffy_Pillow 9.0/100: 9% fury blood_frenzy
3:29.687 throw_glaive Fluffy_Pillow 38.0/100: 38% fury blood_frenzy
3:31.013 demons_bite Fluffy_Pillow 38.0/100: 38% fury blood_frenzy
3:32.339 blade_dance Fluffy_Pillow 61.0/100: 61% fury blood_frenzy
3:33.666 demons_bite Fluffy_Pillow 26.0/100: 26% fury blood_frenzy
3:34.990 demons_bite Fluffy_Pillow 51.0/100: 51% fury blood_frenzy
3:36.315 chaos_strike Fluffy_Pillow 76.0/100: 76% fury blood_frenzy
3:37.640 throw_glaive Fluffy_Pillow 36.0/100: 36% fury blood_frenzy
3:38.965 demons_bite Fluffy_Pillow 36.0/100: 36% fury
3:40.397 Waiting 0.600 sec 66.0/100: 66% fury raid_movement
3:40.997 auto_attack Fluffy_Pillow 66.0/100: 66% fury
3:40.997 chaos_strike Fluffy_Pillow 66.0/100: 66% fury
3:42.428 pick_up_fragment Fluffy_Pillow 46.0/100: 46% fury blood_frenzy
3:42.428 chaos_strike Fluffy_Pillow 46.0/100: 46% fury blood_frenzy
3:43.754 fel_rush Fluffy_Pillow 36.0/100: 36% fury blood_frenzy
3:44.148 chaos_strike Fluffy_Pillow 61.0/100: 61% fury blood_frenzy
3:45.474 chaos_strike Fluffy_Pillow 41.0/100: 41% fury blood_frenzy
3:46.801 demons_bite Fluffy_Pillow 1.0/100: 1% fury blood_frenzy
3:48.127 demons_bite Fluffy_Pillow 24.0/100: 24% fury blood_frenzy
3:49.453 chaos_strike Fluffy_Pillow 49.0/100: 49% fury blood_frenzy
3:50.780 throw_glaive Fluffy_Pillow 29.0/100: 29% fury raid_movement, blood_frenzy
3:52.104 Waiting 0.900 sec 29.0/100: 29% fury raid_movement
3:53.004 auto_attack Fluffy_Pillow 29.0/100: 29% fury
3:53.004 demons_bite Fluffy_Pillow 29.0/100: 29% fury
3:54.434 fel_rush Fluffy_Pillow 58.0/100: 58% fury
3:54.786 blade_dance Fluffy_Pillow 83.0/100: 83% fury
3:56.217 fel_rush Fluffy_Pillow 48.0/100: 48% fury raid_movement
3:56.622 throw_glaive Fluffy_Pillow 73.0/100: 73% fury raid_movement
3:58.055 auto_attack Fluffy_Pillow 73.0/100: 73% fury
3:58.055 demons_bite Fluffy_Pillow 73.0/100: 73% fury
3:59.486 chaos_strike Fluffy_Pillow 93.0/100: 93% fury
4:00.917 nemesis Fluffy_Pillow_Add1 73.0/100: 73% fury
4:02.433 demons_bite Fluffy_Pillow 73.0/100: 73% fury
4:03.864 chaos_strike Fluffy_Pillow 93.0/100: 93% fury
4:05.296 fury_of_the_illidari Fluffy_Pillow 73.0/100: 73% fury
4:06.727 blade_dance Fluffy_Pillow 73.0/100: 73% fury rage_of_the_illidari
4:08.159 throw_glaive Fluffy_Pillow 38.0/100: 38% fury rage_of_the_illidari
4:09.590 demons_bite Fluffy_Pillow 38.0/100: 38% fury
4:11.022 chaos_strike Fluffy_Pillow 68.0/100: 68% fury nemesis_buff
4:12.453 Waiting 0.600 sec 28.0/100: 28% fury raid_movement, nemesis_buff
4:13.053 auto_attack Fluffy_Pillow 28.0/100: 28% fury nemesis_buff
4:13.053 pick_up_fragment Fluffy_Pillow 28.0/100: 28% fury nemesis_buff
4:13.053 demons_bite Fluffy_Pillow 28.0/100: 28% fury nemesis_buff
4:14.483 fel_rush Fluffy_Pillow 54.0/100: 54% fury nemesis_buff
4:14.889 chaos_strike Fluffy_Pillow 79.0/100: 79% fury nemesis_buff, blood_frenzy
4:16.214 pick_up_fragment Fluffy_Pillow 39.0/100: 39% fury nemesis_buff, blood_frenzy
4:16.214 demons_bite Fluffy_Pillow 39.0/100: 39% fury nemesis_buff, blood_frenzy
4:17.540 chaos_strike Fluffy_Pillow 66.0/100: 66% fury nemesis_buff, blood_frenzy
4:18.865 chaos_strike Fluffy_Pillow 56.0/100: 56% fury nemesis_buff, blood_frenzy
4:20.192 throw_glaive Fluffy_Pillow 16.0/100: 16% fury raid_movement, nemesis_buff, blood_frenzy
4:21.518 Waiting 1.500 sec 16.0/100: 16% fury raid_movement, nemesis_buff, blood_frenzy
4:23.018 auto_attack Fluffy_Pillow 16.0/100: 16% fury nemesis_buff, blood_frenzy
4:23.018 demons_bite Fluffy_Pillow 16.0/100: 16% fury nemesis_buff, blood_frenzy
4:24.344 blade_dance Fluffy_Pillow 38.0/100: 38% fury nemesis_buff, blood_frenzy
4:25.669 fel_rush Fluffy_Pillow 3.0/100: 3% fury nemesis_buff, blood_frenzy
4:26.098 throw_glaive Fluffy_Pillow 28.0/100: 28% fury nemesis_buff, blood_frenzy
4:27.422 demons_bite Fluffy_Pillow 28.0/100: 28% fury nemesis_buff, blood_frenzy
4:28.747 fel_rush Fluffy_Pillow 57.0/100: 57% fury raid_movement, nemesis_buff, blood_frenzy
4:29.119 auto_attack Fluffy_Pillow 82.0/100: 82% fury nemesis_buff, blood_frenzy
4:29.119 eye_beam Fluffy_Pillow 82.0/100: 82% fury nemesis_buff, blood_frenzy
4:31.141 demons_bite Fluffy_Pillow 32.0/100: 32% fury nemesis_buff, blood_frenzy
4:32.468 throw_glaive Fluffy_Pillow 59.0/100: 59% fury nemesis_buff, blood_frenzy
4:33.794 blade_dance Fluffy_Pillow 59.0/100: 59% fury nemesis_buff, blood_frenzy
4:35.118 demons_bite Fluffy_Pillow 24.0/100: 24% fury nemesis_buff, blood_frenzy
4:36.444 demons_bite Fluffy_Pillow 50.0/100: 50% fury nemesis_buff, blood_frenzy
4:37.769 demons_bite Fluffy_Pillow 72.0/100: 72% fury nemesis_buff, blood_frenzy
4:39.095 chaos_strike Fluffy_Pillow 100.0/100: 100% fury nemesis_buff, blood_frenzy
4:40.421 pick_up_fragment Fluffy_Pillow 60.0/100: 60% fury nemesis_buff, blood_frenzy
4:40.421 chaos_strike Fluffy_Pillow 60.0/100: 60% fury nemesis_buff, blood_frenzy
4:41.747 chaos_strike Fluffy_Pillow 40.0/100: 40% fury nemesis_buff
4:43.179 demons_bite Fluffy_Pillow 30.0/100: 30% fury nemesis_buff
4:44.611 throw_glaive Fluffy_Pillow 60.0/100: 60% fury raid_movement, nemesis_buff
4:46.044 auto_attack Fluffy_Pillow 60.0/100: 60% fury nemesis_buff
4:46.044 fel_rush Fluffy_Pillow 60.0/100: 60% fury nemesis_buff
4:46.426 chaos_strike Fluffy_Pillow 85.0/100: 85% fury nemesis_buff, blood_frenzy
4:47.753 chaos_strike Fluffy_Pillow 45.0/100: 45% fury nemesis_buff, blood_frenzy
4:49.080 demons_bite Fluffy_Pillow 5.0/100: 5% fury nemesis_buff, blood_frenzy
4:50.406 throw_glaive Fluffy_Pillow 26.0/100: 26% fury raid_movement, nemesis_buff, blood_frenzy
4:51.732 Waiting 1.300 sec 26.0/100: 26% fury raid_movement, nemesis_buff, blood_frenzy
4:53.032 auto_attack Fluffy_Pillow 26.0/100: 26% fury nemesis_buff, blood_frenzy
4:53.032 demons_bite Fluffy_Pillow 26.0/100: 26% fury nemesis_buff, blood_frenzy
4:54.358 blade_dance Fluffy_Pillow 55.0/100: 55% fury nemesis_buff, blood_frenzy
4:55.684 demons_bite Fluffy_Pillow 20.0/100: 20% fury nemesis_buff, blood_frenzy
4:57.010 fel_rush Fluffy_Pillow 48.0/100: 48% fury nemesis_buff
4:57.438 demons_bite Fluffy_Pillow 73.0/100: 73% fury nemesis_buff
4:58.870 throw_glaive Fluffy_Pillow 96.0/100: 96% fury nemesis_buff
5:00.302 fel_rush Fluffy_Pillow 96.0/100: 96% fury raid_movement, nemesis_buff
5:00.720 Waiting 0.300 sec 100.0/100: 100% fury raid_movement, nemesis_buff
5:01.020 auto_attack Fluffy_Pillow 100.0/100: 100% fury
5:01.020 chaos_strike Fluffy_Pillow 100.0/100: 100% fury
5:02.453 pick_up_fragment Fluffy_Pillow 60.0/100: 60% fury
5:02.453 demons_bite Fluffy_Pillow 60.0/100: 60% fury
5:03.884 blade_dance Fluffy_Pillow 80.0/100: 80% fury
5:05.317 pick_up_fragment Fluffy_Pillow 45.0/100: 45% fury
5:05.317 fury_of_the_illidari Fluffy_Pillow 45.0/100: 45% fury
5:06.747 chaos_strike Fluffy_Pillow 75.0/100: 75% fury rage_of_the_illidari
5:08.178 throw_glaive Fluffy_Pillow 35.0/100: 35% fury rage_of_the_illidari
5:09.610 demons_bite Fluffy_Pillow 35.0/100: 35% fury blood_frenzy
5:10.936 chaos_strike Fluffy_Pillow 58.0/100: 58% fury blood_frenzy
5:12.260 demons_bite Fluffy_Pillow 18.0/100: 18% fury blood_frenzy
5:13.587 demons_bite Fluffy_Pillow 38.0/100: 38% fury blood_frenzy
5:14.912 eye_beam Fluffy_Pillow 67.0/100: 67% fury blood_frenzy
5:16.439 chaos_blades Fluffy_Pillow 17.0/100: 17% fury raid_movement, metamorphosis, blood_frenzy
5:16.439 fel_rush Fluffy_Pillow 17.0/100: 17% fury raid_movement, metamorphosis, chaos_blades, blood_frenzy
5:16.836 throw_glaive Fluffy_Pillow 42.0/100: 42% fury raid_movement, metamorphosis, chaos_blades, blood_frenzy
5:18.240 auto_attack Fluffy_Pillow 42.0/100: 42% fury chaos_blades
5:18.240 fel_rush Fluffy_Pillow 42.0/100: 42% fury chaos_blades
5:18.639 chaos_strike Fluffy_Pillow 67.0/100: 67% fury chaos_blades
5:20.069 demons_bite Fluffy_Pillow 27.0/100: 27% fury chaos_blades
5:21.502 chaos_strike Fluffy_Pillow 50.0/100: 50% fury chaos_blades
5:22.933 demons_bite Fluffy_Pillow 30.0/100: 30% fury chaos_blades
5:24.366 chaos_strike Fluffy_Pillow 58.0/100: 58% fury chaos_blades
5:25.797 pick_up_fragment Fluffy_Pillow 18.0/100: 18% fury chaos_blades
5:25.797 demons_bite Fluffy_Pillow 18.0/100: 18% fury chaos_blades
5:27.228 throw_glaive Fluffy_Pillow 77.0/100: 77% fury chaos_blades
5:28.659 chaos_strike Fluffy_Pillow 77.0/100: 77% fury blood_frenzy
5:29.984 chaos_strike Fluffy_Pillow 57.0/100: 57% fury blood_frenzy
5:31.312 demons_bite Fluffy_Pillow 17.0/100: 17% fury blood_frenzy
5:32.636 fel_rush Fluffy_Pillow 44.0/100: 44% fury raid_movement, blood_frenzy
5:33.104 auto_attack Fluffy_Pillow 69.0/100: 69% fury blood_frenzy
5:33.104 chaos_strike Fluffy_Pillow 69.0/100: 69% fury blood_frenzy
5:34.429 demons_bite Fluffy_Pillow 29.0/100: 29% fury blood_frenzy
5:35.753 throw_glaive Fluffy_Pillow 56.0/100: 56% fury blood_frenzy
5:37.078 fel_rush Fluffy_Pillow 56.0/100: 56% fury blood_frenzy
5:37.407 chaos_strike Fluffy_Pillow 81.0/100: 81% fury
5:38.839 chaos_strike Fluffy_Pillow 61.0/100: 61% fury
5:40.270 chaos_strike Fluffy_Pillow 41.0/100: 41% fury
5:41.701 pick_up_fragment Fluffy_Pillow 21.0/100: 21% fury
5:41.701 demons_bite Fluffy_Pillow 21.0/100: 21% fury
5:43.134 chaos_strike Fluffy_Pillow 74.0/100: 74% fury
5:44.567 throw_glaive Fluffy_Pillow 34.0/100: 34% fury
5:46.000 demons_bite Fluffy_Pillow 34.0/100: 34% fury
5:47.431 chaos_strike Fluffy_Pillow 55.0/100: 55% fury
5:48.860 fel_rush Fluffy_Pillow 15.0/100: 15% fury raid_movement
5:49.297 auto_attack Fluffy_Pillow 40.0/100: 40% fury
5:49.297 chaos_strike Fluffy_Pillow 40.0/100: 40% fury
5:50.727 demons_bite Fluffy_Pillow 20.0/100: 20% fury
5:52.157 chaos_strike Fluffy_Pillow 47.0/100: 47% fury
5:53.587 demons_bite Fluffy_Pillow 7.0/100: 7% fury
5:55.018 throw_glaive Fluffy_Pillow 31.0/100: 31% fury
5:56.450 demons_bite Fluffy_Pillow 31.0/100: 31% fury
5:57.881 chaos_strike Fluffy_Pillow 58.0/100: 58% fury
5:59.314 demons_bite Fluffy_Pillow 18.0/100: 18% fury
6:00.746 demons_bite Fluffy_Pillow 39.0/100: 39% fury
6:02.178 eye_beam Fluffy_Pillow 60.0/100: 60% fury
6:04.275 fel_rush Fluffy_Pillow 10.0/100: 10% fury raid_movement
6:04.684 throw_glaive Fluffy_Pillow 35.0/100: 35% fury raid_movement, blood_frenzy
6:06.009 auto_attack Fluffy_Pillow 35.0/100: 35% fury blood_frenzy
6:06.009 fury_of_the_illidari Fluffy_Pillow 35.0/100: 35% fury blood_frenzy
6:07.335 fel_rush Fluffy_Pillow 35.0/100: 35% fury rage_of_the_illidari, blood_frenzy
6:07.778 chaos_strike Fluffy_Pillow 60.0/100: 60% fury rage_of_the_illidari, blood_frenzy
6:09.104 pick_up_fragment Fluffy_Pillow 20.0/100: 20% fury blood_frenzy
6:09.104 demons_bite Fluffy_Pillow 20.0/100: 20% fury blood_frenzy
6:10.430 chaos_strike Fluffy_Pillow 79.0/100: 79% fury blood_frenzy
6:11.756 chaos_strike Fluffy_Pillow 59.0/100: 59% fury blood_frenzy
6:13.081 potion Fluffy_Pillow 39.0/100: 39% fury blood_frenzy
6:13.081 throw_glaive Fluffy_Pillow 39.0/100: 39% fury blood_frenzy, potion_of_the_old_war
6:14.428 demons_bite Fluffy_Pillow 39.0/100: 39% fury potion_of_the_old_war
6:15.860 chaos_strike Fluffy_Pillow 63.0/100: 63% fury potion_of_the_old_war
6:17.290 chaos_strike Fluffy_Pillow 43.0/100: 43% fury potion_of_the_old_war
6:18.722 demons_bite Fluffy_Pillow 3.0/100: 3% fury potion_of_the_old_war
6:20.153 fel_rush Fluffy_Pillow 31.0/100: 31% fury raid_movement, potion_of_the_old_war
6:20.510 Waiting 0.500 sec 56.0/100: 56% fury raid_movement, potion_of_the_old_war
6:21.010 auto_attack Fluffy_Pillow 56.0/100: 56% fury potion_of_the_old_war
6:21.010 chaos_strike Fluffy_Pillow 56.0/100: 56% fury potion_of_the_old_war
6:22.441 throw_glaive Fluffy_Pillow 36.0/100: 36% fury potion_of_the_old_war
6:23.953 demons_bite Fluffy_Pillow 36.0/100: 36% fury potion_of_the_old_war
6:25.384 chaos_strike Fluffy_Pillow 61.0/100: 61% fury potion_of_the_old_war
6:26.815 pick_up_fragment Fluffy_Pillow 21.0/100: 21% fury potion_of_the_old_war
6:26.815 fel_rush Fluffy_Pillow 21.0/100: 21% fury potion_of_the_old_war
6:27.401 chaos_strike Fluffy_Pillow 46.0/100: 46% fury potion_of_the_old_war
6:28.833 demons_bite Fluffy_Pillow 36.0/100: 36% fury blood_frenzy, potion_of_the_old_war
6:30.158 chaos_strike Fluffy_Pillow 59.0/100: 59% fury blood_frenzy, potion_of_the_old_war
6:31.484 throw_glaive Fluffy_Pillow 19.0/100: 19% fury blood_frenzy, potion_of_the_old_war
6:33.039 demons_bite Fluffy_Pillow 19.0/100: 19% fury blood_frenzy, potion_of_the_old_war
6:34.364 chaos_strike Fluffy_Pillow 40.0/100: 40% fury blood_frenzy, potion_of_the_old_war
6:35.690 demons_bite Fluffy_Pillow 20.0/100: 20% fury blood_frenzy, potion_of_the_old_war

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8803 8478 0
Agility 25483 23777 13614 (9544)
Stamina 31868 31868 20079
Intellect 5328 5003 0
Spirit 2 2 0
Health 1912080 1912080 0
Fury 100 100 0
Crit 41.86% 40.79% 8675
Haste 5.09% 5.09% 1655
Damage / Heal Versatility 8.32% 8.32% 3328
Attack Power 25483 23777 0
Mastery 19.30% 19.30% 3956
Armor 2042 2042 2042
Run Speed 8 0 0

Gear

Source Slot Average Item Level: 857.00
Local Head Magic-Warped Hood
ilevel: 865, stats: { 281 Armor, +2237 Sta, +1491 AgiInt, +956 Mastery, +424 Crit }
Local Neck Blackened Portalstone Necklace
ilevel: 860, stats: { +1201 Sta, +1252 Crit, +653 Haste }
Local Shoulders Otherworldy Leather Mantle
ilevel: 850, stats: { 247 Armor, +1459 Sta, +973 AgiInt, +594 Crit, +385 Mastery }
Local Chest Grove Keeper's Robe
ilevel: 850, stats: { 329 Armor, +1945 Sta, +1297 AgiInt, +904 Crit, +400 Haste }
Local Waist Steelgazer Hide Belt
ilevel: 835, stats: { 176 Armor, +846 AgiInt, +1269 Sta, +602 Haste, +324 Vers }
Local Legs Splotched Bloodfur Leggings
ilevel: 850, stats: { 288 Armor, +1945 Sta, +1297 AgiInt, +932 Crit, +372 Mastery }
Local Feet Dreadleather Footpads of the Quickblade
ilevel: 850, stats: { 226 Armor, +1459 Sta, +973 AgiInt, +490 Crit, +490 Vers }
Local Wrists Wristwraps of Broken Trust
ilevel: 850, stats: { 144 Armor, +1094 Sta, +729 AgiInt, +445 Mastery, +288 Crit }
Local Hands Dreadleather Gloves of the Quickblade
ilevel: 850, stats: { 206 Armor, +1459 Sta, +973 AgiInt, +279 Crit, +699 Vers }
Local Finger1 Dingy Suramar Mercantile Signet
ilevel: 865, stats: { +1258 Sta, +1387 Crit, +555 Vers }, enchant: { +150 Vers }
Local Finger2 Ring of Deep Sea Pearls
ilevel: 860, stats: { +1201 Sta, +1198 Mastery, +708 Vers }, enchant: { +150 Vers }
Local Trinket1 An'she's Token of Guile
ilevel: 850, stats: { +1233 Agi, +932 Crit }
Local Trinket2 Bloodthirsty Instinct
ilevel: 850, stats: { +1233 Agi }
Local Back Drape of the Mana-Starved
ilevel: 880, stats: { 145 Armor, +1448 Sta, +965 StrAgiInt, +569 Crit, +252 Vers }, enchant: { +200 Agi }
Local Main Hand Twinblades of the Deceiver
ilevel: 875, weapon: { 4159 - 7725, 2.6 }, stats: { +702 Agi, +1052 Sta, +312 Crit, +300 Mastery }, relics: { +45 ilevels, +43 ilevels, +37 ilevels }
Local Off Hand Twinblades of the Deceiver
ilevel: 875, weapon: { 4159 - 7725, 2.6 }, stats: { +702 Agi, +1052 Sta, +312 Crit, +300 Mastery }

Talents

Level
15 Fel Mastery (Havoc Demon Hunter) Chaos Cleave (Havoc Demon Hunter) Blind Fury (Havoc Demon Hunter)
30 Prepared (Havoc Demon Hunter) Demon Blades (Havoc Demon Hunter) Demonic Appetite (Havoc Demon Hunter)
45 Felblade First Blood (Havoc Demon Hunter) Bloodlet (Havoc Demon Hunter)
60 Netherwalk (Havoc Demon Hunter) Desperate Instincts (Havoc Demon Hunter) Soul Rending (Havoc Demon Hunter)
75 Momentum (Havoc Demon Hunter) Fel Eruption (Havoc Demon Hunter) Nemesis (Havoc Demon Hunter)
90 Master of the Glaive (Havoc Demon Hunter) Unleashed Power (Havoc Demon Hunter) Demon Reborn (Havoc Demon Hunter)
100 Chaos Blades (Havoc Demon Hunter) Fel Barrage (Havoc Demon Hunter) Demonic (Havoc Demon Hunter)

Profile

demonhunter="Illistan"
origin="https://us.api.battle.net/wow/character/thrall/Illistan/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/238/157220590-avatar.jpg"
level=110
race=blood_elf
role=attack
position=back
professions=enchanting=54/herbalism=336
talents=1333311
talent_override=fel_barrage,if=active_enemies>1|raid_event.adds.exists
artifact=3:0:0:0:0:1001:3:1002:3:1003:3:1004:2:1005:3:1006:3:1010:1:1012:1:1013:1:1015:1:1016:1:1330:1
spec=havoc

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war
actions.precombat+=/metamorphosis

# Executed every time the actor is available.
actions=auto_attack
# "Getting ready to use meta" conditions, this is used in a few places.
actions+=/variable,name=pooling_for_meta,value=cooldown.metamorphosis.ready&buff.metamorphosis.down&(!talent.demonic.enabled|!cooldown.eye_beam.ready)&(!talent.chaos_blades.enabled|cooldown.chaos_blades.ready)&(!talent.nemesis.enabled|debuff.nemesis.up|cooldown.nemesis.ready)
# Blade Dance conditions. Always if First Blood is talented, otherwise 3+ targets with Chaos Cleave or 2+ targets without.
actions+=/variable,name=blade_dance,value=talent.first_blood.enabled|spell_targets.blade_dance1>=2+talent.chaos_cleave.enabled
# Blade Dance pooling condition, so we don't spend too much fury when we need it soon. No need to pool on
# single target since First Blood already makes it cheap enough and delaying it a tiny bit isn't a big deal.
actions+=/variable,name=pooling_for_blade_dance,value=variable.blade_dance&fury-40<35-talent.first_blood.enabled*20&spell_targets.blade_dance1>=2
actions+=/blur,if=artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
actions+=/call_action_list,name=cooldown
# Fel Rush in at the start of combat.
actions+=/fel_rush,animation_cancel=1,if=time=0
actions+=/pick_up_fragment,if=talent.demonic_appetite.enabled&fury.deficit>=30
actions+=/consume_magic
# Vengeful Retreat backwards through the target to minimize downtime.
actions+=/vengeful_retreat,if=(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
# Fel Rush for Momentum and for fury from Fel Mastery.
actions+=/fel_rush,animation_cancel=1,if=(talent.momentum.enabled|talent.fel_mastery.enabled)&(!talent.momentum.enabled|(charges=2|cooldown.vengeful_retreat.remains>4)&buff.momentum.down)&(!talent.fel_mastery.enabled|fury.deficit>=25)&(charges=2|(raid_event.movement.in>10&raid_event.adds.in>10))
# Use Fel Barrage at max charges, saving it for Momentum and adds if possible.
actions+=/fel_barrage,if=charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
actions+=/throw_glaive,if=talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
actions+=/fury_of_the_illidari,if=active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
actions+=/eye_beam,if=talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
actions+=/death_sweep,if=variable.blade_dance
actions+=/blade_dance,if=variable.blade_dance
actions+=/throw_glaive,if=talent.bloodlet.enabled&spell_targets>=2+talent.chaos_cleave.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&(spell_targets>=3|raid_event.adds.in>recharge_time+cooldown)
actions+=/fel_eruption
actions+=/felblade,if=fury.deficit>=30+buff.prepared.up*8
actions+=/annihilation,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
actions+=/throw_glaive,if=talent.bloodlet.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&raid_event.adds.in>recharge_time+cooldown
actions+=/eye_beam,if=!talent.demonic.enabled&((spell_targets.eye_beam_tick>desired_targets&active_enemies>1)|(raid_event.adds.in>45&!variable.pooling_for_meta&buff.metamorphosis.down&(artifact.anguish_of_the_deceiver.enabled|active_enemies>1)))
# If Demonic is talented, pool fury as Eye Beam is coming off cooldown.
actions+=/demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<gcd&fury.deficit>=20
actions+=/demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<2*gcd&fury.deficit>=45
actions+=/throw_glaive,if=buff.metamorphosis.down&spell_targets>=2
actions+=/chaos_strike,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
# Use Fel Barrage if its nearing max charges, saving it for Momentum and adds if possible.
actions+=/fel_barrage,if=charges=4&buff.metamorphosis.down&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
actions+=/fel_rush,animation_cancel=1,if=!talent.momentum.enabled&raid_event.movement.in>charges*10
actions+=/demons_bite
actions+=/throw_glaive,if=buff.out_of_range.up|buff.raid_movement.up
actions+=/felblade,if=movement.distance|buff.out_of_range.up
actions+=/fel_rush,if=movement.distance>15|(buff.out_of_range.up&!talent.momentum.enabled)
actions+=/vengeful_retreat,if=movement.distance>15

actions.cooldown=nemesis,target_if=min:target.time_to_die,if=raid_event.adds.exists&debuff.nemesis.down&(active_enemies>desired_targets|raid_event.adds.in>60)
actions.cooldown+=/nemesis,if=!raid_event.adds.exists&(cooldown.metamorphosis.remains>100|target.time_to_die<70)
actions.cooldown+=/nemesis,sync=metamorphosis,if=!raid_event.adds.exists
actions.cooldown+=/chaos_blades,if=buff.metamorphosis.up|cooldown.metamorphosis.remains>100|target.time_to_die<20
actions.cooldown+=/metamorphosis,if=variable.pooling_for_meta&fury.deficit<30&(talent.chaos_blades.enabled|!cooldown.fury_of_the_illidari.ready)
actions.cooldown+=/potion,name=old_war,if=buff.metamorphosis.remains>25|target.time_to_die<30

head=magicwarped_hood,id=141453,bonus_id=1477/3336
neck=blackened_portalstone_necklace,id=139332,bonus_id=1807/1482/3336
shoulders=otherworldy_leather_mantle,id=139206,bonus_id=1807/1472
back=drape_of_the_manastarved,id=141543,bonus_id=1492/3337,enchant=200agi
chest=grove_keepers_robe,id=139207,bonus_id=1807/1808/1472
wrists=wristwraps_of_broken_trust,id=139209,bonus_id=1807/1472
hands=dreadleather_gloves,id=128886,bonus_id=689/1682/3408/601/669
waist=steelgazer_hide_belt,id=134155,bonus_id=3432/1497/1674
legs=splotched_bloodfur_leggings,id=139201,bonus_id=1807/1472
feet=dreadleather_footpads,id=128885,bonus_id=689/1679/3408/600/669
finger1=dingy_suramar_mercantile_signet,id=141492,bonus_id=1808/1477/3336,enchant=150vers
finger2=ring_of_deep_sea_pearls,id=141545,bonus_id=1472,enchant=150vers
trinket1=anshes_token_of_guile,id=139113,bonus_id=3397/603/1512/3337
trinket2=bloodthirsty_instinct,id=139329,bonus_id=1807/1472
main_hand=twinblades_of_the_deceiver,id=127829,bonus_id=719,gem_id=139267/139251/141277/0,relic_id=1807:1477:3336/1807:1472/3397:1492:1675/0
off_hand=twinblades_of_the_deceiver,id=127830

# Gear Summary
# gear_ilvl=857.19
# gear_agility=13614
# gear_stamina=20079
# gear_crit_rating=8675
# gear_haste_rating=1655
# gear_mastery_rating=3956
# gear_versatility_rating=3328
# gear_armor=2042

Mortwraith

Mortwraith : 549740 dps, 224428 dps to main target

  • Race: Blood Elf
  • Class: Demonhunter
  • Spec: Havoc
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
549739.9 549739.9 935.6 / 0.170% 174913.6 / 31.8% 44253.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
12.3 12.3 Fury 1.89% 60.9 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Mortwraith/advanced
Talents
  • 15: Fel Mastery (Havoc Demon Hunter)
  • 30: Prepared (Havoc Demon Hunter)
  • 45: Bloodlet (Havoc Demon Hunter)
  • 60: Soul Rending (Havoc Demon Hunter)
  • 75: Momentum (Havoc Demon Hunter)
  • 90: Master of the Glaive (Havoc Demon Hunter)
  • 100: Fel Barrage (Havoc Demon Hunter)
  • Talent Calculator
Artifact
Professions
  • alchemy: 4
  • herbalism: 80
Scale Factors for Mortwraith Damage Per Second
Agi Vers Crit Mastery Haste
Scale Factors 18.63 12.48 10.49 8.63 0.78
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 1.19 1.18 1.18 1.17 1.15
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Mastery > Haste
Pawn string ( Pawn: v1: "Mortwraith": Agility=18.63, CritRating=10.49, HasteRating=0.78, MasteryRating=8.63, Versatility=12.48 )

Scale Factors for other metrics

Scale Factors for Mortwraith Damage Per Second
Agi Vers Crit Mastery Haste
Scale Factors 18.63 12.48 10.49 8.63 0.78
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 1.19 1.18 1.18 1.17 1.15
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Mastery > Haste
Pawn string ( Pawn: v1: "Mortwraith": Agility=18.63, CritRating=10.49, HasteRating=0.78, MasteryRating=8.63, Versatility=12.48 )
Scale Factors for Mortwraith Priority Target Damage Per Second
Agi Crit Vers Mastery Haste
Scale Factors 7.00 5.12 5.08 3.07 3.06
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.17 0.17 0.17 0.17 0.17
Gear Ranking
Optimizers
Ranking
  • Agi > Crit ~= Vers > Mastery ~= Haste
Pawn string ( Pawn: v1: "Mortwraith": Agility=7.00, CritRating=5.12, HasteRating=3.06, MasteryRating=3.07, Versatility=5.08 )
Scale Factors for Mortwraith Damage Per Second (Effective)
Agi Vers Crit Mastery Haste
Scale Factors 18.63 12.48 10.49 8.63 0.78
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Mastery > Haste
Pawn string ( Pawn: v1: "Mortwraith": Agility=18.63, CritRating=10.49, HasteRating=0.78, MasteryRating=8.63, Versatility=12.48 )
Scale Factors for Mortwraith Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Mortwraith Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Mortwraith Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Mortwraith Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Mortwraith Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Mortwraith Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Mortwraith Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for MortwraithTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Mortwraith 549740
Annihilation 15208 2.8% 16.0 18.57sec 376674 395699 Direct 31.9 132047 288033 188343 36.1% 0.0%  

Stats details: annihilation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.97 31.93 0.00 0.00 0.9519 0.0000 6014236.04 6014236.04 0.00 395699.46 395699.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.41 63.91% 132046.96 99259 156191 132073.98 121173 140659 2694588 2694588 0.00
crit 11.53 36.09% 288032.60 216386 340496 287582.94 0 309135 3319648 3319648 0.00
 
 

Action details: annihilation

Static Values
  • id:201427
  • school:chaos
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
Spelldata
  • id:201427
  • name:Annihilation
  • school:chaos
  • tooltip:
  • description:Slice your target for ${$227518sw1+$201428sw1} Chaos damage. Critical strikes refund {$197125s1=20} Fury.
 
auto_attack_mh 7788 1.4% 132.6 3.02sec 23568 11733 Direct 132.6 20175 40344 23568 35.9% 19.1%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 132.57 132.57 0.00 0.00 2.0087 0.0000 3124534.77 4593362.07 31.98 11733.01 11733.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.74 45.06% 20175.08 17742 22366 20176.41 19359 20918 1205176 1771723 31.98
crit 47.57 35.89% 40344.21 35484 44731 40347.09 38411 42581 1919359 2821639 31.98
miss 25.26 19.06% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 3899 0.7% 132.6 3.02sec 11796 5872 Direct 132.6 10087 20172 11796 35.9% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 132.57 132.57 0.00 0.00 2.0087 0.0000 1563844.48 2298999.52 31.98 5872.43 5872.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.75 45.07% 10086.85 8871 11183 10087.51 9711 10489 602644 885944 31.98
crit 47.65 35.94% 20172.02 17742 22366 20172.87 19194 21234 961200 1413055 31.98
miss 25.18 18.99% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Blade Dance 45665 8.3% 18.2 15.69sec 991754 740830 Direct 419.8 31619 63224 42980 35.9% 0.0%  

Stats details: blade_dance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.19 419.83 0.00 0.00 1.3387 0.0000 18044391.00 26526963.99 31.98 740829.78 740829.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 268.91 64.05% 31619.16 16492 71455 31621.26 27683 35806 8502776 12499886 31.98
crit 150.92 35.95% 63224.26 32985 142909 63229.52 53243 74751 9541615 14027078 31.98
 
 

Action details: blade_dance

Static Values
  • id:188499
  • school:physical
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.blade_dance
Spelldata
  • id:188499
  • name:Blade Dance
  • school:physical
  • tooltip:Dodge chance increased by {$s2=100}%.
  • description:Strike all nearby enemies for ${$sw2+2*$199552sw2+$200685sw2} Physical damage, and increase your chance to dodge by {$s2=100}% for {$d=1 second}.
 
Chaos Strike 50890 9.4% 72.0 5.10sec 285996 211853 Direct 143.8 100520 219063 143094 35.9% 0.0%  

Stats details: chaos_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 71.95 143.81 0.00 0.00 1.3500 0.0000 20578758.54 20578758.54 0.00 211852.93 211852.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 92.16 64.08% 100520.35 76353 120315 100495.95 96096 104406 9264111 9264111 0.00
crit 51.65 35.92% 219063.19 166450 262287 219017.00 204145 233994 11314647 11314647 0.00
 
 

Action details: chaos_strike

Static Values
  • id:162794
  • school:chaos
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
Spelldata
  • id:162794
  • name:Chaos Strike
  • school:chaos
  • tooltip:
  • description:Slice your target for ${$222031sw1+$199547sw1} Chaos damage. Critical strikes refund {$197125s1=20} Fury.
 
Death Sweep 20165 3.6% 5.3 58.07sec 1509629 1516909 Direct 121.6 48151 96391 65532 36.0% 0.0%  

Stats details: death_sweep

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.28 121.57 0.00 0.00 0.9954 0.0000 7966805.97 11711959.42 31.98 1516908.98 1516908.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.77 63.97% 48151.01 24567 106438 48132.44 37615 57113 3744716 5505087 31.98
crit 43.80 36.03% 96391.28 49134 212875 96340.68 69357 128872 4222090 6206873 31.98
 
 

Action details: death_sweep

Static Values
  • id:210152
  • school:physical
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.blade_dance
Spelldata
  • id:210152
  • name:Death Sweep
  • school:physical
  • tooltip:Dodge chance increased by {$s3=0}%.
  • description:Strike all nearby enemies for ${3*$210153sw2+$210155sw2} Physical damage, and increase your Dodge chance by {$s2=100}% for {$d=1 second}.
 
Demon's Bite 16272 3.0% 99.6 3.99sec 65419 51689 Direct 99.6 48119 96238 65418 36.0% 0.0%  

Stats details: demons_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.60 99.60 0.00 0.00 1.2656 0.0000 6515943.97 9579054.84 31.98 51688.82 51688.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.79 64.05% 48118.64 43366 54668 48140.84 46420 50324 3069671 4512708 31.98
crit 35.81 35.95% 96237.92 86732 109335 96280.54 91158 102592 3446273 5066347 31.98
 
 

Action details: demons_bite

Static Values
  • id:162243
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<gcd&fury.deficit>=20
Spelldata
  • id:162243
  • name:Demon's Bite
  • school:physical
  • tooltip:
  • description:Quickly attack for $sw2 Physical damage. |cFFFFFFFFGenerates $m3 to $M3 Fury.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.60
 
Eye Beam 71593 (101216) 13.0% (18.4%) 11.9 32.38sec 3360804 1738871 Periodic 572.6 0 49509 49509 100.0% 0.0% 4.9%

Stats details: eye_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.93 0.00 113.79 572.58 1.9328 0.1720 28347802.48 28347802.48 0.00 1738871.11 1738871.11
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 572.6 100.00% 49508.72 43683 55067 49516.99 44739 52862 28347802 28347802 0.00
 
 

Action details: eye_beam

Static Values
  • id:198013
  • school:chaos
  • resource:fury
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
Spelldata
  • id:198013
  • name:Eye Beam
  • school:chromatic
  • tooltip:
  • description:Blasts all enemies directly in front of you for $<dmg> Chaos damage. Eye Beam always critically strikes.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:2.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Anguish 29623 5.4% 0.0 0.00sec 0 0 Direct 58.3 147879 295555 201085 36.0% 0.0%  

Stats details: anguish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 58.34 0.00 0.00 0.0000 0.0000 11731437.69 11731437.69 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.32 63.97% 147878.72 13461 169687 147435.34 82201 164792 5518947 5518947 0.00
crit 21.02 36.03% 295555.35 26921 339375 294682.30 160317 330861 6212490 6212490 0.00
 
 

Action details: anguish

Static Values
  • id:202446
  • school:chaos
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202446
  • name:Anguish
  • school:chaos
  • tooltip:
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals {$202446s1=10} Chaos damage to the victim per application.}
 
Fel Barrage 48820 8.8% 10.2 41.09sec 1900484 1247947 Direct 159.9 88806 177604 120690 35.9% 0.0%  

Stats details: fel_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.15 159.87 49.37 0.00 1.5229 0.1986 19294506.58 19294506.58 0.00 1247946.87 1247946.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 102.46 64.09% 88805.85 67304 106055 88815.37 0 106055 9099206 9099206 0.00
crit 57.41 35.91% 177603.60 134607 212109 177633.14 0 212109 10195301 10195301 0.00
 
 

Action details: fel_barrage

Static Values
  • id:211053
  • school:chaos
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Spelldata
  • id:211053
  • name:Fel Barrage
  • school:magic
  • tooltip:Unleashing Fel.
  • description:At your command, unleash Fel, inflicting ${{$211052s1=0}} Chaos damage to your target and nearby enemies for each charge. Max 5 charges. Your damaging abilities have a chance to generate a charge.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:1.00
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Fel Rush 55681 10.1% 34.6 11.81sec 639209 1582220 Direct 123.5 131573 263081 178900 36.0% 0.0%  

Stats details: fel_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.56 123.50 0.00 0.00 0.4040 0.0000 22094119.70 22094119.70 0.00 1582219.97 1582219.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.06 64.01% 131572.94 128617 162136 131500.57 128948 137098 10401836 10401836 0.00
crit 44.44 35.99% 263080.90 257234 324273 262940.81 257234 275163 11692284 11692284 0.00
 
 

Action details: fel_rush

Static Values
  • id:195072
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.2500
  • min_gcd:0.2500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time=0
Spelldata
  • id:195072
  • name:Fel Rush
  • school:physical
  • tooltip:
  • description:Rush forward, incinerating anything in your path for {$192611s1=0} Chaos damage.$?a192939[ |cFFFFFFFFGenerates {$192939s1=25} Fury if you damage an enemy.|r][]
 
Fury of the Illidari 45539 (72842) 8.3% (13.2%) 7.1 60.53sec 4080718 3225859 Periodic 448.0 29637 59258 40282 35.9% 0.0% 5.3%

Stats details: fury_of_the_illidari

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.07 0.00 49.35 447.98 1.2651 0.4283 18045855.27 18045855.27 0.00 959479.72 3225859.19
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 287.0 64.06% 29636.70 17754 42610 29635.64 25950 32407 8505200 8505200 0.00
crit 161.0 35.94% 59257.93 35508 85219 59262.00 50646 67340 9540655 9540655 0.00
 
 

Action details: fury_of_the_illidari

Static Values
  • id:201467
  • school:chaos
  • resource:none
  • range:5.0
  • travel_speed:3.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
Spelldata
  • id:201467
  • name:Fury of the Illidari
  • school:physical
  • tooltip:
  • description:Throws the |cFFFFCC99Twinblades of the Deceiver|r in a whirlwind of energy, causing ${7*($201628sw1+$201789sw1)} Chaos damage over {$d=3 seconds} to all nearby enemies.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Rage of the Illidari 27302 5.0% 7.0 60.53sec 1540111 0 Direct 31.8 340053 0 340053 0.0% 0.0%  

Stats details: rage_of_the_illidari

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.02 31.82 0.00 0.00 0.0000 0.0000 10819132.74 10819132.74 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.82 100.00% 340052.64 223700 2211436 340653.59 297002 789875 10819133 10819133 0.00
 
 

Action details: rage_of_the_illidari

Static Values
  • id:217070
  • school:chaos
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:217070
  • name:Rage of the Illidari
  • school:chaos
  • tooltip:
  • description:{$@spelldesc201472=When Fury of the Illidari ends, {$s1=60}% of the damage it dealt erupts in an explosion of fel energy, dividing that Chaos damage among all neaby enemies.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:308919.27
  • base_dd_max:308919.27
 
Metamorphosis (_impact) 1779 0.3% 2.0 242.37sec 350292 0 Direct 6.8 75686 151296 103058 36.2% 0.0%  

Stats details: metamorphosis_impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.01 6.83 0.00 0.00 0.0000 0.0000 703456.21 703456.21 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.35 63.79% 75686.23 67304 84844 75046.70 0 84844 329573 329573 0.00
crit 2.47 36.21% 151296.36 134607 169687 142447.89 0 169687 373883 373883 0.00
 
 

Action details: metamorphosis_impact

Static Values
  • id:200166
  • school:chaos
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:200166
  • name:Metamorphosis
  • school:chromatic
  • tooltip:Stunned.
  • description:{$@spelldesc191427=Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.}
 
Potion of the Old War 12235 2.2% 24.6 11.81sec 196316 0 Direct 24.6 144478 288902 196318 35.9% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.62 24.62 0.00 0.00 0.0000 0.0000 4834217.66 7106757.87 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.79 64.11% 144477.90 123216 155327 144478.97 133015 155327 2280753 3352923 31.98
crit 8.84 35.89% 288902.40 246432 310654 288910.26 251410 310654 2553465 3753835 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Throw Glaive 41328 (92047) 7.5% (16.8%) 48.6 8.28sec 752859 597874 Direct 109.9 109963 219925 149524 36.0% 0.0%  

Stats details: throw_glaive

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.64 109.88 0.00 0.00 1.2592 0.0000 16429725.15 24153252.24 31.98 597874.36 597874.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.35 64.02% 109962.69 93987 118481 109954.05 103605 114159 7736011 11372668 31.98
crit 39.53 35.98% 219925.28 187975 236963 219910.34 203449 229187 8693714 12780584 31.98
 
 

Action details: throw_glaive

Static Values
  • id:185123
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
Spelldata
  • id:185123
  • name:Throw Glaive
  • school:physical
  • tooltip:
  • description:Throw a demonic glaive at the target, dealing $sw1 Physical damage. The glaive can ricochet to ${$x1-1} additional enemies within 10 yards.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.90
 
    Bloodlet 50718 9.2% 0.0 0.00sec 0 0 Periodic 354.7 56915 0 56915 0.0% 0.0% 176.9%

Stats details: bloodlet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 354.75 354.75 0.0000 2.0000 20190079.19 20190079.19 0.00 28456.85 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 354.7 100.00% 56914.83 28196 151034 56936.88 48258 67595 20190079 20190079 0.00
 
 

Action details: bloodlet

Static Values
  • id:207690
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207690
  • name:Bloodlet
  • school:physical
  • tooltip:Inflicts $w1 damage every $t1 sec.
  • description:{$@spelldesc206473=Throw Glaive causes targets to bleed for {$s1=150}% of the damage inflicted over {$207690d=10 seconds}. If this effect is reapplied, any remaining damage will be added to the new Bloodlet.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Vengeful Retreat 5236 1.0% 25.6 15.83sec 81246 0 Direct 90.3 16923 33845 23005 35.9% 0.0%  

Stats details: vengeful_retreat

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.57 90.30 0.00 0.00 0.0000 0.0000 2077389.72 3053959.66 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.84 64.06% 16922.89 16679 17522 16921.83 16713 17165 978904 1439082 31.98
crit 32.46 35.94% 33845.19 33358 35043 33842.97 33358 34482 1098486 1614878 31.98
 
 

Action details: vengeful_retreat

Static Values
  • id:198793
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
Spelldata
  • id:198793
  • name:Vengeful Retreat
  • school:physical
  • tooltip:
  • description:Remove all snares and vault away. Nearby enemies take $198813sw2 Physical damage and have their movement speed reduced by {$198813s1=70}% for {$198813d=3 seconds}.$?a203551[ |cFFFFFFFFGenerates $203650o1 Fury over {$203650d=5 seconds} if you damage an enemy.|r][]
 
Simple Action Stats Execute Interval
Mortwraith
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mortwraith
  • harmful:false
  • if_expr:
 
Blur 0.3 182.72sec

Stats details: blur

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.32 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: blur

Static Values
  • id:198589
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
Spelldata
  • id:198589
  • name:Blur
  • school:physical
  • tooltip:
  • description:Increases your chance to dodge by {$212800s2=50}% and reduces all damage taken by {$212800s3=35}% for {$212800d=10 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mortwraith
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mortwraith
  • harmful:false
  • if_expr:
 
Metamorphosis 1.0 242.37sec

Stats details: metamorphosis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.01 0.00 0.00 0.00 1.2285 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: metamorphosis

Static Values
  • id:191427
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:240.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191427
  • name:Metamorphosis
  • school:physical
  • tooltip:
  • description:Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blade Dance 18.2 0.0 15.7sec 15.7sec 4.60% 4.60% 0.0(0.0) 18.2

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_blade_dance
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • blade_dance_1:4.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188499
  • name:Blade Dance
  • tooltip:Dodge chance increased by {$s2=100}%.
  • description:Strike all nearby enemies for ${$sw2+2*$199552sw2+$200685sw2} Physical damage, and increase your chance to dodge by {$s2=100}% for {$d=1 second}.
  • max_stacks:0
  • duration:1.00
  • cooldown:10.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.12% 9.58% 0.0(0.0) 1.0

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Blur 0.3 0.0 164.2sec 164.2sec 0.77% 0.77% 0.0(0.0) 0.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_blur
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.35

Stack Uptimes

  • blur_1:0.77%

Trigger Attempt Success

  • trigger_pct:28.74%

Spelldata details

  • id:212800
  • name:Blur
  • tooltip:Dodge increased by {$s2=50}%. All damage reduced by {$s3=35}%.
  • description:{$@spelldesc198589=Increases your chance to dodge by {$212800s2=50}% and reduces all damage taken by {$212800s3=35}% for {$212800d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:60.00
  • default_chance:0.00%
Death Sweep 5.3 0.0 58.2sec 58.2sec 1.34% 1.34% 0.0(0.0) 5.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_death_sweep
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • death_sweep_1:1.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210152
  • name:Death Sweep
  • tooltip:Dodge chance increased by {$s3=0}%.
  • description:Strike all nearby enemies for ${3*$210153sw2+$210155sw2} Physical damage, and increase your Dodge chance by {$s2=100}% for {$d=1 second}.
  • max_stacks:0
  • duration:1.00
  • cooldown:8.00
  • default_chance:0.00%
fel_rush_movement 1.1 0.0 137.2sec 137.2sec 0.07% 0.07% 0.0(0.0) 1.1

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_fel_rush_movement
  • max_stacks:1
  • duration:0.25
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • fel_rush_movement_1:0.07%

Trigger Attempt Success

  • trigger_pct:75.60%
Metamorphosis 12.2 0.6 33.9sec 31.0sec 20.38% 19.35% 0.6(0.6) 12.2

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_metamorphosis
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • metamorphosis_1:20.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162264
  • name:Metamorphosis
  • tooltip:Chaos Strike and Blade Dance upgraded to $@spellname201427 and $@spellname210152. Haste increased by {$s7=25}%.
  • description:{$@spelldesc191427=Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Momentum 59.3 0.8 6.8sec 6.8sec 59.36% 66.08% 0.8(0.8) 58.7

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_momentum
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • momentum_1:59.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:208628
  • name:Momentum
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Increases all damage done by {$s1=20}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
out_of_range 25.5 25.5 15.8sec 7.8sec 2.17% 2.17% 25.5(25.5) 0.0

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_out_of_range
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • out_of_range_1:2.17%

Trigger Attempt Success

  • trigger_pct:100.00%
Potion of the Old War 2.0 0.0 245.8sec 0.0sec 12.15% 12.15% 0.0(0.0) 2.0

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Prepared 25.6 0.0 15.8sec 15.8sec 31.68% 31.68% 253.9(253.9) 25.2

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_prepared
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • prepared_1:31.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:203650
  • name:Prepared
  • tooltip:Generating ${$m1*2} Fury every sec.
  • description:{$@spelldesc203551=Reduces the cooldown of Vengeful Retreat by 10 sec, and generates $203650o1 Fury over {$203650d=5 seconds} if you damage at least one enemy with Vengeful Retreat.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Rage of the Illidari 7.1 440.9 60.5sec 0.8sec 5.28% 5.28% 440.9(440.9) 0.0

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_rage_of_the_illidari
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • rage_of_the_illidari_1:5.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:217060
  • name:Rage of the Illidari
  • tooltip:
  • description:{$@spelldesc201472=When Fury of the Illidari ends, {$s1=60}% of the damage it dealt erupts in an explosion of fel energy, dividing that Chaos damage among all neaby enemies.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 10.23% 10.23% 2.0(2.0) 0.0

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:10.23%

Trigger Attempt Success

  • trigger_pct:100.00%
Rapid Adaptation 7.1 0.0 60.5sec 60.5sec 34.82% 34.82% 0.0(0.0) 6.8

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_rapid_adaptation
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:2154.27

Stack Uptimes

  • rapid_adaptation_1:34.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:170397
  • name:Rapid Adaptation
  • tooltip:Increases Versatility by {$s1=2036}.
  • description:Increases Versatility by {$s1=2036} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
vengeful_retreat_movement 25.6 0.0 15.8sec 15.8sec 6.37% 6.37% 0.0(0.0) 25.5

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_vengeful_retreat_movement
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vengeful_retreat_movement_1:6.37%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Mortwraith
annihilation Fury 16.0 638.7 40.0 40.0 9416.8
blade_dance Fury 18.2 636.8 35.0 35.0 28335.8
chaos_strike Fury 72.0 2878.2 40.0 40.0 7149.9
death_sweep Fury 5.3 184.7 35.0 35.0 43132.3
eye_beam Fury 11.9 596.3 50.0 50.0 67217.0
Resource Gains Type Count Total Average Overflow
prepared Fury 253.91 1005.85 (20.16%) 3.96 9.77 0.96%
fel_rush_dmg Fury 34.56 862.16 (17.28%) 24.94 1.96 0.23%
annihilation Fury 5.76 115.24 (2.31%) 20.00 0.00 0.00%
demons_bite Fury 99.60 2490.02 (49.91%) 25.00 0.00 0.00%
chaos_strike Fury 25.80 516.10 (10.34%) 20.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Fury 12.44 12.31
Combat End Resource Mean Min Max
Fury 55.68 0.00 110.00

Benefits & Uptimes

Benefits %
Uptimes %
Fury Cap 0.5%

Procs

Count Interval
delayed_swing__out_of_range 5.4 89.2sec
delayed_swing__channeling 25.5 31.6sec
demons_bite_in_meta 20.7 14.8sec
fel_barrage 31.6 12.4sec

Statistics & Data Analysis

Fight Length
Sample Data Mortwraith Fight Length
Count 9999
Mean 401.00
Minimum 308.02
Maximum 501.87
Spread ( max - min ) 193.85
Range [ ( max - min ) / 2 * 100% ] 24.17%
DPS
Sample Data Mortwraith Damage Per Second
Count 9999
Mean 549739.87
Minimum 442324.27
Maximum 706601.94
Spread ( max - min ) 264277.66
Range [ ( max - min ) / 2 * 100% ] 24.04%
Standard Deviation 47733.4648
5th Percentile 479953.01
95th Percentile 633566.83
( 95th Percentile - 5th Percentile ) 153613.82
Mean Distribution
Standard Deviation 477.3585
95.00% Confidence Intervall ( 548804.27 - 550675.48 )
Normalized 95.00% Confidence Intervall ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 289
0.1% Error 28961
0.1 Scale Factor Error with Delta=300 19450447
0.05 Scale Factor Error with Delta=300 77801788
0.01 Scale Factor Error with Delta=300 1945044701
Priority Target DPS
Sample Data Mortwraith Priority Target Damage Per Second
Count 9999
Mean 224427.76
Minimum 201863.59
Maximum 256641.71
Spread ( max - min ) 54778.13
Range [ ( max - min ) / 2 * 100% ] 12.20%
Standard Deviation 6881.6758
5th Percentile 213700.01
95th Percentile 236258.32
( 95th Percentile - 5th Percentile ) 22558.31
Mean Distribution
Standard Deviation 68.8202
95.00% Confidence Intervall ( 224292.88 - 224562.65 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3611
0.1 Scale Factor Error with Delta=300 404270
0.05 Scale Factor Error with Delta=300 1617082
0.01 Scale Factor Error with Delta=300 40427052
DPS(e)
Sample Data Mortwraith Damage Per Second (Effective)
Count 9999
Mean 549739.87
Minimum 442324.27
Maximum 706601.94
Spread ( max - min ) 264277.66
Range [ ( max - min ) / 2 * 100% ] 24.04%
Damage
Sample Data Mortwraith Damage
Count 9999
Mean 218376237.19
Minimum 177994039.73
Maximum 256921912.44
Spread ( max - min ) 78927872.70
Range [ ( max - min ) / 2 * 100% ] 18.07%
DTPS
Sample Data Mortwraith Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Mortwraith Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Mortwraith Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Mortwraith Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Mortwraith Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Mortwraith Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data MortwraithTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Mortwraith Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=old_war
5 0.00 metamorphosis
Default action list Executed every time the actor is available.
# count action,conditions
6 48.07 auto_attack
0.00 variable,name=pooling_for_meta,value=cooldown.metamorphosis.ready&buff.metamorphosis.down&(!talent.demonic.enabled|!cooldown.eye_beam.ready)&(!talent.chaos_blades.enabled|cooldown.chaos_blades.ready)&(!talent.nemesis.enabled|debuff.nemesis.up|cooldown.nemesis.ready)
"Getting ready to use meta" conditions, this is used in a few places.
0.00 variable,name=blade_dance,value=talent.first_blood.enabled|spell_targets.blade_dance1>=2+talent.chaos_cleave.enabled
Blade Dance conditions. Always if First Blood is talented, otherwise 3+ targets with Chaos Cleave or 2+ targets without.
0.00 variable,name=pooling_for_blade_dance,value=variable.blade_dance&fury-40<35-talent.first_blood.enabled*20&spell_targets.blade_dance1>=2
Blade Dance pooling condition, so we don't spend too much fury when we need it soon. No need to pool on # single target since First Blood already makes it cheap enough and delaying it a tiny bit isn't a big deal.
7 0.32 blur,if=artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
8 0.00 call_action_list,name=cooldown
9 1.00 fel_rush,animation_cancel=1,if=time=0
Fel Rush in at the start of combat.
0.00 pick_up_fragment,if=talent.demonic_appetite.enabled&fury.deficit>=30
0.00 consume_magic
A 25.59 vengeful_retreat,if=(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
Vengeful Retreat backwards through the target to minimize downtime.
B 32.45 fel_rush,animation_cancel=1,if=(talent.momentum.enabled|talent.fel_mastery.enabled)&(!talent.momentum.enabled|(charges=2|cooldown.vengeful_retreat.remains>4)&buff.momentum.down)&(!talent.fel_mastery.enabled|fury.deficit>=25)&(charges=2|(raid_event.movement.in>10&raid_event.adds.in>10))
Fel Rush for Momentum and for fury from Fel Mastery.
C 4.94 fel_barrage,if=charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Use Fel Barrage at max charges, saving it for Momentum and adds if possible.
D 2.69 throw_glaive,if=talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
E 7.08 fury_of_the_illidari,if=active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
0.00 eye_beam,if=talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
F 5.28 death_sweep,if=variable.blade_dance
G 18.20 blade_dance,if=variable.blade_dance
H 22.58 throw_glaive,if=talent.bloodlet.enabled&spell_targets>=2+talent.chaos_cleave.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&(spell_targets>=3|raid_event.adds.in>recharge_time+cooldown)
0.00 fel_eruption
0.00 felblade,if=fury.deficit>=30+buff.prepared.up*8
I 15.97 annihilation,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
J 10.04 throw_glaive,if=talent.bloodlet.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&raid_event.adds.in>recharge_time+cooldown
K 11.93 eye_beam,if=!talent.demonic.enabled&((spell_targets.eye_beam_tick>desired_targets&active_enemies>1)|(raid_event.adds.in>45&!variable.pooling_for_meta&buff.metamorphosis.down&(artifact.anguish_of_the_deceiver.enabled|active_enemies>1)))
0.00 demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<gcd&fury.deficit>=20
If Demonic is talented, pool fury as Eye Beam is coming off cooldown.
0.00 demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<2*gcd&fury.deficit>=45
L 7.19 throw_glaive,if=buff.metamorphosis.down&spell_targets>=2
M 71.95 chaos_strike,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
N 5.21 fel_barrage,if=charges=4&buff.metamorphosis.down&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Use Fel Barrage if its nearing max charges, saving it for Momentum and adds if possible.
0.00 fel_rush,animation_cancel=1,if=!talent.momentum.enabled&raid_event.movement.in>charges*10
O 99.60 demons_bite
P 6.17 throw_glaive,if=buff.out_of_range.up|buff.raid_movement.up
0.00 felblade,if=movement.distance|buff.out_of_range.up
Q 1.12 fel_rush,if=movement.distance>15|(buff.out_of_range.up&!talent.momentum.enabled)
0.00 vengeful_retreat,if=movement.distance>15
actions.cooldown
# count action,conditions
R 7.40 use_item,slot=trinket2,if=buff.chaos_blades.up|!talent.chaos_blades.enabled
0.00 nemesis,target_if=min:target.time_to_die,if=raid_event.adds.exists&debuff.nemesis.down&(active_enemies>desired_targets|raid_event.adds.in>60)
0.00 nemesis,if=!raid_event.adds.exists&(cooldown.metamorphosis.remains>100|target.time_to_die<70)
0.00 nemesis,sync=metamorphosis,if=!raid_event.adds.exists
0.00 chaos_blades,if=buff.metamorphosis.up|cooldown.metamorphosis.remains>100|target.time_to_die<20
S 1.01 metamorphosis,if=variable.pooling_for_meta&fury.deficit<30&(talent.chaos_blades.enabled|!cooldown.fury_of_the_illidari.ready)
T 1.00 potion,name=old_war,if=buff.metamorphosis.remains>25|target.time_to_die<30

Sample Sequence

012456R9C6DEJAOIOIOIOIBIP6OIOOOIOIADH6FBK6HOFBC6OHGOOAOHMMGOOMBP6MMOA6GOHBK6OORR6GELAOMN6BGMOOMP6OMA6GHOBK6OMGL6OOAOMHGBMMOOOP6MA6GOKBHOMRGOE6OAH6N6MBMMOOOMO6GAH6HK6BOMGOLOOA6MOGBMMOOOMOLA6GHKBNORHGEOMAOH6MMBMMMOOLA6GO6KBHC6OGOOLAMO6MMBMMOOOLA6GK6H6BMN6ROGELOAOSTIIBP6IIOOIOQH6FK6AOOIH6BCFIOOIOFLAO6MMB6MOOOLL6GBK6OOA6ORHGEMBMN6JOOMAM6MOBJMK6OOOMAJ6MOBMJMOOMOAMJ6MBMOMOOOMORACJJ6EK6BMMOOOAJMMB6MJOBMMOOOAJMM

Sample Sequence Table

time name target resources buffs
Pre flask Mortwraith 0.0/110: 0% fury
Pre food Mortwraith 0.0/110: 0% fury
Pre augmentation Mortwraith 0.0/110: 0% fury
Pre potion Fluffy_Pillow 0.0/110: 0% fury potion_of_the_old_war
0:00.000 metamorphosis Fluffy_Pillow 0.0/110: 0% fury metamorphosis, potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 0.0/110: 0% fury metamorphosis, potion_of_the_old_war
0:00.000 use_item_vindictive_gladiators_badge_of_conquest Fluffy_Pillow 0.0/110: 0% fury metamorphosis, potion_of_the_old_war
0:00.000 fel_rush Fluffy_Pillow 0.0/110: 0% fury metamorphosis, potion_of_the_old_war, rapid_adaptation
0:00.445 fel_barrage Fluffy_Pillow 25.0/110: 23% fury metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:01.725 auto_attack Fluffy_Pillow 25.0/110: 23% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:01.725 throw_glaive Fluffy_Pillow 25.0/110: 23% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:02.563 fury_of_the_illidari Fluffy_Pillow 25.0/110: 23% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:03.401 throw_glaive Fluffy_Pillow 25.0/110: 23% fury bloodlust, metamorphosis, momentum, rage_of_the_illidari, potion_of_the_old_war, rapid_adaptation
0:04.239 vengeful_retreat Fluffy_Pillow 25.0/110: 23% fury bloodlust, metamorphosis, rage_of_the_illidari, potion_of_the_old_war, rapid_adaptation
0:04.239 demons_bite Fluffy_Pillow 25.0/110: 23% fury bloodlust, metamorphosis, momentum, prepared, rage_of_the_illidari, vengeful_retreat_movement, potion_of_the_old_war, rapid_adaptation
0:05.076 annihilation Fluffy_Pillow 49.0/110: 45% fury bloodlust, metamorphosis, momentum, prepared, rage_of_the_illidari, vengeful_retreat_movement, potion_of_the_old_war, rapid_adaptation
0:05.915 demons_bite Fluffy_Pillow 37.0/110: 34% fury bloodlust, metamorphosis, momentum, prepared, potion_of_the_old_war, rapid_adaptation
0:06.755 annihilation Fluffy_Pillow 73.0/110: 66% fury bloodlust, metamorphosis, momentum, prepared, potion_of_the_old_war, rapid_adaptation
0:07.592 demons_bite Fluffy_Pillow 37.0/110: 34% fury bloodlust, metamorphosis, momentum, prepared, potion_of_the_old_war, rapid_adaptation
0:08.432 annihilation Fluffy_Pillow 75.0/110: 68% fury bloodlust, metamorphosis, prepared, potion_of_the_old_war, rapid_adaptation
0:09.270 demons_bite Fluffy_Pillow 63.0/110: 57% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:10.109 annihilation Fluffy_Pillow 90.0/110: 82% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:10.947 fel_rush Fluffy_Pillow 50.0/110: 45% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:11.327 annihilation Fluffy_Pillow 75.0/110: 68% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:12.165 throw_glaive Fluffy_Pillow 35.0/110: 32% fury bloodlust, raid_movement, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:13.002 auto_attack Fluffy_Pillow 35.0/110: 32% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:13.002 demons_bite Fluffy_Pillow 35.0/110: 32% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:13.842 annihilation Fluffy_Pillow 59.0/110: 54% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:14.680 demons_bite Fluffy_Pillow 19.0/110: 17% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:15.519 demons_bite Fluffy_Pillow 40.0/110: 36% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:16.358 demons_bite Fluffy_Pillow 68.0/110: 62% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:17.197 annihilation Fluffy_Pillow 95.0/110: 86% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:18.038 demons_bite Fluffy_Pillow 55.0/110: 50% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:18.877 annihilation Fluffy_Pillow 81.0/110: 74% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:19.716 vengeful_retreat Fluffy_Pillow 41.0/110: 37% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:19.716 throw_glaive Fluffy_Pillow 41.0/110: 37% fury bloodlust, metamorphosis, momentum, prepared, vengeful_retreat_movement, potion_of_the_old_war, rapid_adaptation
0:20.553 throw_glaive Fluffy_Pillow 45.0/110: 41% fury bloodlust, raid_movement, metamorphosis, momentum, prepared, vengeful_retreat_movement, potion_of_the_old_war
0:21.391 Waiting 1.600 sec 53.0/110: 48% fury bloodlust, raid_movement, metamorphosis, momentum, prepared, potion_of_the_old_war
0:22.991 auto_attack Fluffy_Pillow 65.0/110: 59% fury bloodlust, metamorphosis, momentum, prepared, potion_of_the_old_war
0:22.991 death_sweep Fluffy_Pillow 65.0/110: 59% fury bloodlust, metamorphosis, momentum, prepared, potion_of_the_old_war
0:23.829 fel_rush Fluffy_Pillow 38.0/110: 35% fury bloodlust, metamorphosis, death_sweep, prepared
0:24.224 eye_beam Fluffy_Pillow 67.0/110: 61% fury bloodlust, metamorphosis, momentum, prepared
0:25.621 auto_attack Fluffy_Pillow 21.0/110: 19% fury bloodlust, metamorphosis, momentum
0:25.621 throw_glaive Fluffy_Pillow 21.0/110: 19% fury bloodlust, metamorphosis, momentum
0:26.460 demons_bite Fluffy_Pillow 21.0/110: 19% fury bloodlust, metamorphosis, momentum
0:27.298 death_sweep Fluffy_Pillow 46.0/110: 42% fury bloodlust, metamorphosis, momentum
0:28.277 fel_rush Fluffy_Pillow 11.0/110: 10% fury bloodlust, raid_movement, metamorphosis, death_sweep
0:28.711 fel_barrage Fluffy_Pillow 36.0/110: 33% fury bloodlust, raid_movement, metamorphosis, momentum
0:29.931 auto_attack Fluffy_Pillow 36.0/110: 33% fury bloodlust, metamorphosis, momentum
0:29.931 demons_bite Fluffy_Pillow 36.0/110: 33% fury bloodlust, metamorphosis, momentum
0:30.769 throw_glaive Fluffy_Pillow 62.0/110: 56% fury bloodlust, momentum
0:31.884 blade_dance Fluffy_Pillow 62.0/110: 56% fury bloodlust, momentum
0:32.935 demons_bite Fluffy_Pillow 27.0/110: 25% fury bloodlust
0:33.980 demons_bite Fluffy_Pillow 50.0/110: 45% fury bloodlust
0:35.025 vengeful_retreat Fluffy_Pillow 73.0/110: 66% fury bloodlust
0:35.025 demons_bite Fluffy_Pillow 73.0/110: 66% fury bloodlust, momentum, prepared, vengeful_retreat_movement
0:36.072 Waiting 0.100 sec 107.0/110: 97% fury bloodlust, momentum, out_of_range, prepared
0:36.172 throw_glaive Fluffy_Pillow 107.0/110: 97% fury bloodlust, momentum, out_of_range, prepared
0:37.445 chaos_strike Fluffy_Pillow 110.0/110: 100% fury bloodlust, momentum, prepared
0:38.490 chaos_strike Fluffy_Pillow 78.0/110: 71% fury bloodlust, momentum, prepared
0:39.536 blade_dance Fluffy_Pillow 70.0/110: 64% fury bloodlust, prepared
0:40.583 demons_bite Fluffy_Pillow 39.0/110: 35% fury bloodlust
0:41.630 demons_bite Fluffy_Pillow 65.0/110: 59% fury
0:42.991 chaos_strike Fluffy_Pillow 93.0/110: 85% fury
0:44.350 fel_rush Fluffy_Pillow 53.0/110: 48% fury raid_movement
0:44.766 throw_glaive Fluffy_Pillow 78.0/110: 71% fury raid_movement, momentum
0:46.125 auto_attack Fluffy_Pillow 78.0/110: 71% fury momentum
0:46.125 chaos_strike Fluffy_Pillow 78.0/110: 71% fury momentum
0:47.484 chaos_strike Fluffy_Pillow 58.0/110: 53% fury momentum
0:48.844 demons_bite Fluffy_Pillow 18.0/110: 16% fury
0:50.203 vengeful_retreat Fluffy_Pillow 46.0/110: 42% fury raid_movement
0:50.203 Waiting 0.400 sec 46.0/110: 42% fury raid_movement, momentum, prepared, vengeful_retreat_movement
0:50.603 auto_attack Fluffy_Pillow 46.0/110: 42% fury momentum, prepared, vengeful_retreat_movement
0:50.603 blade_dance Fluffy_Pillow 46.0/110: 42% fury momentum, prepared, vengeful_retreat_movement
0:51.963 demons_bite Fluffy_Pillow 23.0/110: 21% fury momentum, prepared
0:53.323 throw_glaive Fluffy_Pillow 55.0/110: 50% fury momentum, prepared
0:54.684 fel_rush Fluffy_Pillow 63.0/110: 57% fury prepared
0:55.030 eye_beam Fluffy_Pillow 92.0/110: 84% fury momentum, prepared
0:57.079 auto_attack Fluffy_Pillow 46.0/110: 42% fury momentum
0:57.079 demons_bite Fluffy_Pillow 46.0/110: 42% fury momentum
0:58.438 demons_bite Fluffy_Pillow 72.0/110: 65% fury momentum
0:59.799 use_item_vindictive_gladiators_badge_of_conquest Fluffy_Pillow 100.0/110: 91% fury
1:00.000 use_item_vindictive_gladiators_badge_of_conquest Fluffy_Pillow 100.0/110: 91% fury raid_movement
1:00.000 Waiting 1.000 sec 100.0/110: 91% fury raid_movement, rapid_adaptation
1:01.000 auto_attack Fluffy_Pillow 100.0/110: 91% fury rapid_adaptation
1:01.000 blade_dance Fluffy_Pillow 100.0/110: 91% fury rapid_adaptation
1:02.359 fury_of_the_illidari Fluffy_Pillow 65.0/110: 59% fury rapid_adaptation
1:03.922 throw_glaive Fluffy_Pillow 65.0/110: 59% fury rage_of_the_illidari, rapid_adaptation
1:05.282 vengeful_retreat Fluffy_Pillow 65.0/110: 59% fury rage_of_the_illidari, rapid_adaptation
1:05.282 demons_bite Fluffy_Pillow 65.0/110: 59% fury momentum, prepared, rage_of_the_illidari, vengeful_retreat_movement, rapid_adaptation
1:06.642 chaos_strike Fluffy_Pillow 95.0/110: 86% fury momentum, prepared, rapid_adaptation
1:07.999 fel_barrage Fluffy_Pillow 67.0/110: 61% fury momentum, prepared, rapid_adaptation
1:09.578 auto_attack Fluffy_Pillow 79.0/110: 72% fury prepared, rapid_adaptation
1:09.578 fel_rush Fluffy_Pillow 79.0/110: 72% fury prepared, rapid_adaptation
1:09.957 blade_dance Fluffy_Pillow 108.0/110: 98% fury momentum, prepared, rapid_adaptation
1:11.397 chaos_strike Fluffy_Pillow 77.0/110: 70% fury momentum, rapid_adaptation
1:12.755 demons_bite Fluffy_Pillow 37.0/110: 34% fury momentum, rapid_adaptation
1:14.115 demons_bite Fluffy_Pillow 63.0/110: 57% fury rapid_adaptation
1:15.477 chaos_strike Fluffy_Pillow 87.0/110: 79% fury rapid_adaptation
1:16.837 throw_glaive Fluffy_Pillow 67.0/110: 61% fury raid_movement, rapid_adaptation
1:18.197 auto_attack Fluffy_Pillow 67.0/110: 61% fury rapid_adaptation
1:18.197 demons_bite Fluffy_Pillow 67.0/110: 61% fury rapid_adaptation
1:19.556 chaos_strike Fluffy_Pillow 88.0/110: 80% fury rapid_adaptation
1:20.914 vengeful_retreat Fluffy_Pillow 48.0/110: 44% fury raid_movement
1:20.914 auto_attack Fluffy_Pillow 48.0/110: 44% fury momentum, prepared, vengeful_retreat_movement
1:20.914 blade_dance Fluffy_Pillow 48.0/110: 44% fury momentum, prepared, vengeful_retreat_movement
1:22.275 throw_glaive Fluffy_Pillow 21.0/110: 19% fury momentum, prepared
1:23.634 demons_bite Fluffy_Pillow 33.0/110: 30% fury momentum, prepared
1:24.994 fel_rush Fluffy_Pillow 74.0/110: 67% fury prepared
1:25.425 eye_beam Fluffy_Pillow 103.0/110: 94% fury momentum, prepared
1:27.425 auto_attack Fluffy_Pillow 57.0/110: 52% fury momentum
1:27.425 demons_bite Fluffy_Pillow 57.0/110: 52% fury momentum
1:28.785 chaos_strike Fluffy_Pillow 80.0/110: 73% fury momentum
1:30.145 blade_dance Fluffy_Pillow 40.0/110: 36% fury
1:31.503 throw_glaive Fluffy_Pillow 5.0/110: 5% fury
1:32.863 Waiting 0.100 sec 5.0/110: 5% fury raid_movement
1:32.963 auto_attack Fluffy_Pillow 5.0/110: 5% fury
1:32.963 demons_bite Fluffy_Pillow 5.0/110: 5% fury
1:34.323 demons_bite Fluffy_Pillow 34.0/110: 31% fury
1:35.683 vengeful_retreat Fluffy_Pillow 55.0/110: 50% fury
1:35.914 demons_bite Fluffy_Pillow 55.0/110: 50% fury momentum, prepared, vengeful_retreat_movement
1:37.274 chaos_strike Fluffy_Pillow 84.0/110: 76% fury momentum, prepared
1:38.633 throw_glaive Fluffy_Pillow 76.0/110: 69% fury momentum, prepared
1:39.993 blade_dance Fluffy_Pillow 88.0/110: 80% fury prepared
1:41.353 fel_rush Fluffy_Pillow 61.0/110: 55% fury
1:41.782 chaos_strike Fluffy_Pillow 86.0/110: 78% fury momentum
1:43.142 chaos_strike Fluffy_Pillow 46.0/110: 42% fury momentum
1:44.501 demons_bite Fluffy_Pillow 26.0/110: 24% fury momentum
1:45.860 demons_bite Fluffy_Pillow 48.0/110: 44% fury
1:47.220 demons_bite Fluffy_Pillow 76.0/110: 69% fury
1:48.580 throw_glaive Fluffy_Pillow 105.0/110: 95% fury raid_movement
1:49.939 auto_attack Fluffy_Pillow 105.0/110: 95% fury
1:49.939 chaos_strike Fluffy_Pillow 105.0/110: 95% fury
1:51.299 vengeful_retreat Fluffy_Pillow 65.0/110: 59% fury raid_movement
1:51.299 auto_attack Fluffy_Pillow 65.0/110: 59% fury momentum, prepared, vengeful_retreat_movement
1:51.299 blade_dance Fluffy_Pillow 65.0/110: 59% fury momentum, prepared, vengeful_retreat_movement
1:52.658 demons_bite Fluffy_Pillow 38.0/110: 35% fury momentum, prepared
1:54.019 eye_beam Fluffy_Pillow 71.0/110: 65% fury momentum, prepared
1:56.116 fel_rush Fluffy_Pillow 37.0/110: 34% fury prepared
1:56.534 throw_glaive Fluffy_Pillow 66.0/110: 60% fury momentum
1:57.894 demons_bite Fluffy_Pillow 66.0/110: 60% fury momentum
1:59.253 chaos_strike Fluffy_Pillow 89.0/110: 81% fury momentum
2:00.611 use_item_vindictive_gladiators_badge_of_conquest Fluffy_Pillow 49.0/110: 45% fury
2:00.611 blade_dance Fluffy_Pillow 49.0/110: 45% fury rapid_adaptation
2:01.970 demons_bite Fluffy_Pillow 14.0/110: 13% fury rapid_adaptation
2:03.329 fury_of_the_illidari Fluffy_Pillow 38.0/110: 35% fury rapid_adaptation
2:04.687 Waiting 0.300 sec 38.0/110: 35% fury raid_movement, rage_of_the_illidari, rapid_adaptation
2:04.987 auto_attack Fluffy_Pillow 38.0/110: 35% fury rage_of_the_illidari, rapid_adaptation
2:04.987 demons_bite Fluffy_Pillow 38.0/110: 35% fury rage_of_the_illidari, rapid_adaptation
2:06.347 vengeful_retreat Fluffy_Pillow 59.0/110: 54% fury rapid_adaptation
2:06.347 throw_glaive Fluffy_Pillow 59.0/110: 54% fury momentum, prepared, vengeful_retreat_movement, rapid_adaptation
2:07.709 auto_attack Fluffy_Pillow 67.0/110: 61% fury momentum, prepared, rapid_adaptation
2:07.709 fel_barrage Fluffy_Pillow 67.0/110: 61% fury momentum, prepared, rapid_adaptation
2:09.333 auto_attack Fluffy_Pillow 79.0/110: 72% fury momentum, prepared, rapid_adaptation
2:09.333 chaos_strike Fluffy_Pillow 79.0/110: 72% fury momentum, prepared, rapid_adaptation
2:10.693 fel_rush Fluffy_Pillow 51.0/110: 46% fury prepared, rapid_adaptation
2:11.092 chaos_strike Fluffy_Pillow 80.0/110: 73% fury momentum, prepared, rapid_adaptation
2:12.450 chaos_strike Fluffy_Pillow 64.0/110: 58% fury momentum, rapid_adaptation
2:13.809 demons_bite Fluffy_Pillow 24.0/110: 22% fury momentum, rapid_adaptation
2:15.170 demons_bite Fluffy_Pillow 45.0/110: 41% fury rapid_adaptation
2:16.530 demons_bite Fluffy_Pillow 75.0/110: 68% fury rapid_adaptation
2:17.890 chaos_strike Fluffy_Pillow 96.0/110: 87% fury rapid_adaptation
2:19.250 demons_bite Fluffy_Pillow 56.0/110: 51% fury rapid_adaptation
2:20.607 auto_attack Fluffy_Pillow 81.0/110: 74% fury rapid_adaptation
2:20.607 blade_dance Fluffy_Pillow 81.0/110: 74% fury rapid_adaptation
2:21.966 vengeful_retreat Fluffy_Pillow 46.0/110: 42% fury
2:21.966 throw_glaive Fluffy_Pillow 46.0/110: 42% fury momentum, prepared, vengeful_retreat_movement
2:23.326 auto_attack Fluffy_Pillow 54.0/110: 49% fury momentum, prepared
2:23.326 throw_glaive Fluffy_Pillow 54.0/110: 49% fury momentum, prepared
2:24.806 eye_beam Fluffy_Pillow 66.0/110: 60% fury momentum, prepared
2:26.905 auto_attack Fluffy_Pillow 32.0/110: 29% fury prepared
2:26.905 fel_rush Fluffy_Pillow 32.0/110: 29% fury prepared
2:27.354 demons_bite Fluffy_Pillow 61.0/110: 55% fury momentum
2:28.713 chaos_strike Fluffy_Pillow 82.0/110: 75% fury momentum
2:30.075 blade_dance Fluffy_Pillow 42.0/110: 38% fury momentum
2:31.434 demons_bite Fluffy_Pillow 7.0/110: 6% fury
2:32.794 throw_glaive Fluffy_Pillow 30.0/110: 27% fury
2:34.154 demons_bite Fluffy_Pillow 30.0/110: 27% fury
2:35.512 demons_bite Fluffy_Pillow 60.0/110: 55% fury
2:36.873 vengeful_retreat Fluffy_Pillow 83.0/110: 75% fury raid_movement
2:36.966 auto_attack Fluffy_Pillow 83.0/110: 75% fury momentum, prepared, vengeful_retreat_movement
2:36.966 chaos_strike Fluffy_Pillow 83.0/110: 75% fury momentum, prepared, vengeful_retreat_movement
2:38.326 demons_bite Fluffy_Pillow 51.0/110: 46% fury momentum, prepared
2:39.686 blade_dance Fluffy_Pillow 88.0/110: 80% fury momentum, prepared
2:41.044 fel_rush Fluffy_Pillow 65.0/110: 59% fury prepared
2:41.465 chaos_strike Fluffy_Pillow 90.0/110: 82% fury momentum, prepared
2:42.823 chaos_strike Fluffy_Pillow 58.0/110: 53% fury momentum
2:44.182 demons_bite Fluffy_Pillow 18.0/110: 16% fury momentum
2:45.542 demons_bite Fluffy_Pillow 48.0/110: 44% fury
2:46.902 demons_bite Fluffy_Pillow 77.0/110: 70% fury
2:48.263 chaos_strike Fluffy_Pillow 105.0/110: 95% fury
2:49.622 demons_bite Fluffy_Pillow 65.0/110: 59% fury
2:50.981 throw_glaive Fluffy_Pillow 91.0/110: 83% fury raid_movement
2:52.339 vengeful_retreat Fluffy_Pillow 91.0/110: 83% fury raid_movement
2:52.339 auto_attack Fluffy_Pillow 91.0/110: 83% fury momentum, prepared, vengeful_retreat_movement
2:52.339 blade_dance Fluffy_Pillow 91.0/110: 83% fury momentum, prepared, vengeful_retreat_movement
2:53.697 throw_glaive Fluffy_Pillow 64.0/110: 58% fury momentum, prepared
2:55.057 eye_beam Fluffy_Pillow 76.0/110: 69% fury momentum, prepared
2:57.036 fel_rush Fluffy_Pillow 42.0/110: 38% fury metamorphosis, prepared
2:57.440 fel_barrage Fluffy_Pillow 71.0/110: 65% fury momentum
2:59.050 demons_bite Fluffy_Pillow 71.0/110: 65% fury momentum
3:00.409 use_item_vindictive_gladiators_badge_of_conquest Fluffy_Pillow 96.0/110: 87% fury momentum
3:00.611 throw_glaive Fluffy_Pillow 96.0/110: 87% fury momentum, rapid_adaptation
3:01.971 blade_dance Fluffy_Pillow 96.0/110: 87% fury rapid_adaptation
3:03.330 fury_of_the_illidari Fluffy_Pillow 61.0/110: 55% fury rapid_adaptation
3:04.690 demons_bite Fluffy_Pillow 61.0/110: 55% fury rage_of_the_illidari, rapid_adaptation
3:06.050 chaos_strike Fluffy_Pillow 90.0/110: 82% fury rage_of_the_illidari, rapid_adaptation
3:07.411 vengeful_retreat Fluffy_Pillow 50.0/110: 45% fury rapid_adaptation
3:07.411 demons_bite Fluffy_Pillow 50.0/110: 45% fury momentum, prepared, vengeful_retreat_movement, rapid_adaptation
3:08.769 Waiting 0.100 sec 88.0/110: 80% fury raid_movement, momentum, prepared, rapid_adaptation
3:08.869 throw_glaive Fluffy_Pillow 88.0/110: 80% fury raid_movement, momentum, prepared, rapid_adaptation
3:10.413 auto_attack Fluffy_Pillow 104.0/110: 95% fury momentum, prepared, rapid_adaptation
3:10.413 chaos_strike Fluffy_Pillow 104.0/110: 95% fury momentum, prepared, rapid_adaptation
3:11.773 chaos_strike Fluffy_Pillow 92.0/110: 84% fury prepared, rapid_adaptation
3:13.132 fel_rush Fluffy_Pillow 80.0/110: 73% fury rapid_adaptation
3:13.445 chaos_strike Fluffy_Pillow 105.0/110: 95% fury momentum, rapid_adaptation
3:14.805 chaos_strike Fluffy_Pillow 65.0/110: 59% fury momentum, rapid_adaptation
3:16.163 chaos_strike Fluffy_Pillow 45.0/110: 41% fury momentum, rapid_adaptation
3:17.522 demons_bite Fluffy_Pillow 5.0/110: 5% fury rapid_adaptation
3:18.881 demons_bite Fluffy_Pillow 30.0/110: 27% fury rapid_adaptation
3:20.242 throw_glaive Fluffy_Pillow 54.0/110: 49% fury raid_movement, rapid_adaptation
3:21.602 Waiting 0.600 sec 54.0/110: 49% fury raid_movement
3:22.202 vengeful_retreat Fluffy_Pillow 54.0/110: 49% fury raid_movement
3:22.411 auto_attack Fluffy_Pillow 54.0/110: 49% fury momentum, prepared, vengeful_retreat_movement
3:22.411 blade_dance Fluffy_Pillow 54.0/110: 49% fury momentum, prepared, vengeful_retreat_movement
3:23.771 demons_bite Fluffy_Pillow 27.0/110: 25% fury momentum, prepared
3:25.131 auto_attack Fluffy_Pillow 66.0/110: 60% fury momentum, prepared
3:25.131 eye_beam Fluffy_Pillow 66.0/110: 60% fury momentum, prepared
3:27.110 fel_rush Fluffy_Pillow 32.0/110: 29% fury metamorphosis, prepared
3:27.540 throw_glaive Fluffy_Pillow 61.0/110: 55% fury momentum
3:28.899 fel_barrage Fluffy_Pillow 61.0/110: 55% fury momentum
3:30.488 auto_attack Fluffy_Pillow 61.0/110: 55% fury momentum
3:30.488 demons_bite Fluffy_Pillow 61.0/110: 55% fury momentum
3:31.847 blade_dance Fluffy_Pillow 89.0/110: 81% fury
3:33.205 demons_bite Fluffy_Pillow 54.0/110: 49% fury
3:34.566 demons_bite Fluffy_Pillow 78.0/110: 71% fury
3:35.927 throw_glaive Fluffy_Pillow 99.0/110: 90% fury
3:37.521 vengeful_retreat Fluffy_Pillow 99.0/110: 90% fury
3:37.521 chaos_strike Fluffy_Pillow 99.0/110: 90% fury momentum, prepared, vengeful_retreat_movement
3:38.878 demons_bite Fluffy_Pillow 67.0/110: 61% fury momentum, prepared
3:40.237 Waiting 0.700 sec 105.0/110: 95% fury raid_movement, momentum, prepared
3:40.937 auto_attack Fluffy_Pillow 109.0/110: 99% fury momentum, prepared
3:40.937 chaos_strike Fluffy_Pillow 109.0/110: 99% fury momentum, prepared
3:42.296 chaos_strike Fluffy_Pillow 101.0/110: 92% fury prepared
3:43.655 fel_rush Fluffy_Pillow 65.0/110: 59% fury
3:44.035 chaos_strike Fluffy_Pillow 90.0/110: 82% fury momentum
3:45.394 chaos_strike Fluffy_Pillow 70.0/110: 64% fury momentum
3:46.754 demons_bite Fluffy_Pillow 30.0/110: 27% fury momentum
3:48.115 demons_bite Fluffy_Pillow 56.0/110: 51% fury
3:49.476 demons_bite Fluffy_Pillow 76.0/110: 69% fury
3:50.837 throw_glaive Fluffy_Pillow 96.0/110: 87% fury raid_movement
3:52.196 Waiting 0.100 sec 96.0/110: 87% fury raid_movement
3:52.296 vengeful_retreat Fluffy_Pillow 96.0/110: 87% fury raid_movement
3:52.521 auto_attack Fluffy_Pillow 96.0/110: 87% fury momentum, prepared, vengeful_retreat_movement
3:52.521 blade_dance Fluffy_Pillow 96.0/110: 87% fury momentum, prepared, vengeful_retreat_movement
3:53.879 eye_beam Fluffy_Pillow 69.0/110: 63% fury momentum, prepared
3:55.966 auto_attack Fluffy_Pillow 35.0/110: 32% fury momentum, prepared
3:55.966 throw_glaive Fluffy_Pillow 35.0/110: 32% fury momentum, prepared
3:57.327 auto_attack Fluffy_Pillow 47.0/110: 43% fury prepared
3:57.327 fel_rush Fluffy_Pillow 47.0/110: 43% fury prepared
3:57.686 chaos_strike Fluffy_Pillow 76.0/110: 69% fury momentum
3:59.046 fel_barrage Fluffy_Pillow 56.0/110: 51% fury momentum
4:00.642 auto_attack Fluffy_Pillow 56.0/110: 51% fury momentum
4:00.642 use_item_vindictive_gladiators_badge_of_conquest Fluffy_Pillow 56.0/110: 51% fury momentum
4:00.642 demons_bite Fluffy_Pillow 56.0/110: 51% fury momentum, rapid_adaptation
4:02.002 blade_dance Fluffy_Pillow 77.0/110: 70% fury rapid_adaptation
4:03.361 fury_of_the_illidari Fluffy_Pillow 42.0/110: 38% fury rapid_adaptation
4:04.721 throw_glaive Fluffy_Pillow 42.0/110: 38% fury rage_of_the_illidari, rapid_adaptation
4:06.081 demons_bite Fluffy_Pillow 42.0/110: 38% fury rage_of_the_illidari, rapid_adaptation
4:07.441 vengeful_retreat Fluffy_Pillow 70.0/110: 64% fury rapid_adaptation
4:07.521 demons_bite Fluffy_Pillow 70.0/110: 64% fury momentum, prepared, vengeful_retreat_movement, rapid_adaptation
4:08.881 metamorphosis Fluffy_Pillow 105.0/110: 95% fury momentum, prepared, rapid_adaptation
4:10.111 potion Fluffy_Pillow 110.0/110: 100% fury metamorphosis, momentum, prepared, rapid_adaptation
4:10.111 annihilation Fluffy_Pillow 110.0/110: 100% fury metamorphosis, momentum, prepared, potion_of_the_old_war, rapid_adaptation
4:11.199 annihilation Fluffy_Pillow 78.0/110: 71% fury metamorphosis, momentum, prepared, potion_of_the_old_war, rapid_adaptation
4:12.288 fel_rush Fluffy_Pillow 46.0/110: 42% fury raid_movement, metamorphosis, prepared, potion_of_the_old_war, rapid_adaptation
4:12.748 throw_glaive Fluffy_Pillow 75.0/110: 68% fury raid_movement, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
4:13.838 auto_attack Fluffy_Pillow 75.0/110: 68% fury metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
4:13.838 annihilation Fluffy_Pillow 75.0/110: 68% fury metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
4:14.926 annihilation Fluffy_Pillow 55.0/110: 50% fury metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
4:16.015 demons_bite Fluffy_Pillow 35.0/110: 32% fury metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
4:17.103 demons_bite Fluffy_Pillow 63.0/110: 57% fury metamorphosis, potion_of_the_old_war, rapid_adaptation
4:18.190 annihilation Fluffy_Pillow 89.0/110: 81% fury metamorphosis, potion_of_the_old_war, rapid_adaptation
4:19.278 demons_bite Fluffy_Pillow 49.0/110: 45% fury metamorphosis, potion_of_the_old_war, rapid_adaptation
4:20.365 fel_rush Fluffy_Pillow 76.0/110: 69% fury raid_movement, metamorphosis, potion_of_the_old_war, rapid_adaptation
4:20.798 Waiting 0.300 sec 101.0/110: 92% fury metamorphosis, momentum, out_of_range, potion_of_the_old_war
4:21.098 throw_glaive Fluffy_Pillow 101.0/110: 92% fury metamorphosis, momentum, out_of_range, potion_of_the_old_war
4:22.432 auto_attack Fluffy_Pillow 101.0/110: 92% fury metamorphosis, momentum, potion_of_the_old_war
4:22.432 death_sweep Fluffy_Pillow 101.0/110: 92% fury metamorphosis, momentum, potion_of_the_old_war
4:23.521 eye_beam Fluffy_Pillow 66.0/110: 60% fury metamorphosis, momentum, potion_of_the_old_war
4:25.296 auto_attack Fluffy_Pillow 16.0/110: 15% fury metamorphosis, potion_of_the_old_war
4:25.296 vengeful_retreat Fluffy_Pillow 16.0/110: 15% fury metamorphosis, potion_of_the_old_war
4:25.296 demons_bite Fluffy_Pillow 16.0/110: 15% fury metamorphosis, momentum, prepared, vengeful_retreat_movement, potion_of_the_old_war
4:26.385 Waiting 0.200 sec 47.0/110: 43% fury metamorphosis, momentum, out_of_range, prepared, potion_of_the_old_war
4:26.585 demons_bite Fluffy_Pillow 47.0/110: 43% fury metamorphosis, momentum, prepared, potion_of_the_old_war
4:27.673 annihilation Fluffy_Pillow 82.0/110: 75% fury metamorphosis, momentum, prepared, potion_of_the_old_war
4:28.760 throw_glaive Fluffy_Pillow 70.0/110: 64% fury raid_movement, metamorphosis, momentum, prepared, potion_of_the_old_war
4:29.850 auto_attack Fluffy_Pillow 82.0/110: 75% fury metamorphosis, prepared, potion_of_the_old_war
4:29.850 fel_rush Fluffy_Pillow 82.0/110: 75% fury metamorphosis, prepared, potion_of_the_old_war
4:30.264 fel_barrage Fluffy_Pillow 107.0/110: 97% fury metamorphosis, momentum, prepared, potion_of_the_old_war
4:31.620 death_sweep Fluffy_Pillow 110.0/110: 100% fury metamorphosis, momentum, potion_of_the_old_war
4:32.709 annihilation Fluffy_Pillow 75.0/110: 68% fury metamorphosis, momentum, potion_of_the_old_war
4:33.799 demons_bite Fluffy_Pillow 35.0/110: 32% fury metamorphosis, momentum, potion_of_the_old_war
4:34.887 demons_bite Fluffy_Pillow 59.0/110: 54% fury metamorphosis, potion_of_the_old_war
4:35.977 annihilation Fluffy_Pillow 79.0/110: 72% fury metamorphosis
4:37.068 demons_bite Fluffy_Pillow 39.0/110: 35% fury metamorphosis
4:38.158 death_sweep Fluffy_Pillow 69.0/110: 63% fury metamorphosis
4:39.245 throw_glaive Fluffy_Pillow 34.0/110: 31% fury
4:40.605 vengeful_retreat Fluffy_Pillow 34.0/110: 31% fury
4:40.605 demons_bite Fluffy_Pillow 34.0/110: 31% fury momentum, prepared, vengeful_retreat_movement
4:41.964 auto_attack Fluffy_Pillow 71.0/110: 65% fury momentum, prepared
4:41.964 chaos_strike Fluffy_Pillow 71.0/110: 65% fury momentum, prepared
4:43.324 chaos_strike Fluffy_Pillow 43.0/110: 39% fury momentum, prepared
4:44.684 fel_rush Fluffy_Pillow 15.0/110: 14% fury raid_movement, prepared
4:45.060 auto_attack Fluffy_Pillow 40.0/110: 36% fury momentum, prepared
4:45.060 chaos_strike Fluffy_Pillow 40.0/110: 36% fury momentum, prepared
4:46.420 demons_bite Fluffy_Pillow 8.0/110: 7% fury momentum
4:47.781 demons_bite Fluffy_Pillow 28.0/110: 25% fury momentum
4:49.140 demons_bite Fluffy_Pillow 58.0/110: 53% fury
4:50.502 throw_glaive Fluffy_Pillow 80.0/110: 73% fury raid_movement
4:51.861 throw_glaive Fluffy_Pillow 80.0/110: 73% fury raid_movement
4:53.419 auto_attack Fluffy_Pillow 80.0/110: 73% fury
4:53.419 blade_dance Fluffy_Pillow 80.0/110: 73% fury
4:54.778 fel_rush Fluffy_Pillow 45.0/110: 41% fury
4:55.216 eye_beam Fluffy_Pillow 70.0/110: 64% fury momentum
4:57.315 auto_attack Fluffy_Pillow 20.0/110: 18% fury momentum
4:57.315 demons_bite Fluffy_Pillow 20.0/110: 18% fury momentum
4:58.674 demons_bite Fluffy_Pillow 48.0/110: 44% fury momentum
5:00.034 vengeful_retreat Fluffy_Pillow 70.0/110: 64% fury raid_movement
5:00.034 auto_attack Fluffy_Pillow 70.0/110: 64% fury momentum, prepared, vengeful_retreat_movement
5:00.034 demons_bite Fluffy_Pillow 70.0/110: 64% fury momentum, prepared, vengeful_retreat_movement
5:01.394 use_item_vindictive_gladiators_badge_of_conquest Fluffy_Pillow 105.0/110: 95% fury momentum, prepared
5:01.394 throw_glaive Fluffy_Pillow 105.0/110: 95% fury momentum, prepared, rapid_adaptation
5:02.753 blade_dance Fluffy_Pillow 110.0/110: 100% fury momentum, prepared, rapid_adaptation
5:04.113 fury_of_the_illidari Fluffy_Pillow 87.0/110: 79% fury prepared, rapid_adaptation
5:05.474 chaos_strike Fluffy_Pillow 95.0/110: 86% fury rage_of_the_illidari, rapid_adaptation
5:06.835 fel_rush Fluffy_Pillow 55.0/110: 50% fury rage_of_the_illidari, rapid_adaptation
5:07.290 chaos_strike Fluffy_Pillow 80.0/110: 73% fury momentum, rapid_adaptation
5:08.651 fel_barrage Fluffy_Pillow 40.0/110: 36% fury momentum, rapid_adaptation
5:10.337 auto_attack Fluffy_Pillow 40.0/110: 36% fury momentum, rapid_adaptation
5:10.337 throw_glaive Fluffy_Pillow 40.0/110: 36% fury momentum, rapid_adaptation
5:11.696 demons_bite Fluffy_Pillow 40.0/110: 36% fury rapid_adaptation
5:13.056 demons_bite Fluffy_Pillow 64.0/110: 58% fury rapid_adaptation
5:14.417 chaos_strike Fluffy_Pillow 93.0/110: 85% fury rapid_adaptation
5:15.775 vengeful_retreat Fluffy_Pillow 73.0/110: 66% fury rapid_adaptation
5:15.775 chaos_strike Fluffy_Pillow 73.0/110: 66% fury momentum, prepared, vengeful_retreat_movement, rapid_adaptation
5:17.134 auto_attack Fluffy_Pillow 41.0/110: 37% fury momentum, prepared, rapid_adaptation
5:17.134 chaos_strike Fluffy_Pillow 41.0/110: 37% fury momentum, prepared, rapid_adaptation
5:18.493 demons_bite Fluffy_Pillow 33.0/110: 30% fury momentum, prepared, rapid_adaptation
5:19.853 fel_rush Fluffy_Pillow 72.0/110: 65% fury prepared, rapid_adaptation
5:20.328 throw_glaive Fluffy_Pillow 101.0/110: 92% fury momentum, prepared, rapid_adaptation
5:21.687 chaos_strike Fluffy_Pillow 105.0/110: 95% fury momentum
5:23.049 eye_beam Fluffy_Pillow 65.0/110: 59% fury momentum
5:25.100 auto_attack Fluffy_Pillow 15.0/110: 14% fury
5:25.100 demons_bite Fluffy_Pillow 15.0/110: 14% fury
5:26.458 demons_bite Fluffy_Pillow 41.0/110: 37% fury
5:27.819 demons_bite Fluffy_Pillow 63.0/110: 57% fury
5:29.177 chaos_strike Fluffy_Pillow 90.0/110: 82% fury
5:30.536 vengeful_retreat Fluffy_Pillow 50.0/110: 45% fury
5:30.775 throw_glaive Fluffy_Pillow 50.0/110: 45% fury momentum, prepared, vengeful_retreat_movement
5:32.133 Waiting 0.800 sec 58.0/110: 53% fury raid_movement, momentum, prepared
5:32.933 auto_attack Fluffy_Pillow 66.0/110: 60% fury momentum, prepared
5:32.933 chaos_strike Fluffy_Pillow 66.0/110: 60% fury momentum, prepared
5:34.292 demons_bite Fluffy_Pillow 38.0/110: 35% fury momentum, prepared
5:35.651 fel_rush Fluffy_Pillow 69.0/110: 63% fury prepared
5:36.060 chaos_strike Fluffy_Pillow 98.0/110: 89% fury momentum
5:37.419 throw_glaive Fluffy_Pillow 78.0/110: 71% fury momentum
5:38.779 chaos_strike Fluffy_Pillow 78.0/110: 71% fury momentum
5:40.137 demons_bite Fluffy_Pillow 38.0/110: 35% fury
5:41.494 demons_bite Fluffy_Pillow 58.0/110: 53% fury
5:42.853 chaos_strike Fluffy_Pillow 81.0/110: 74% fury
5:44.212 demons_bite Fluffy_Pillow 61.0/110: 55% fury
5:45.572 vengeful_retreat Fluffy_Pillow 83.0/110: 75% fury
5:45.775 chaos_strike Fluffy_Pillow 83.0/110: 75% fury momentum, prepared, vengeful_retreat_movement
5:47.135 throw_glaive Fluffy_Pillow 51.0/110: 46% fury momentum, prepared
5:48.495 Waiting 0.500 sec 63.0/110: 57% fury raid_movement, momentum, prepared
5:48.995 auto_attack Fluffy_Pillow 67.0/110: 61% fury momentum, prepared
5:48.995 chaos_strike Fluffy_Pillow 67.0/110: 61% fury momentum, prepared
5:50.354 fel_rush Fluffy_Pillow 39.0/110: 35% fury prepared
5:50.720 chaos_strike Fluffy_Pillow 64.0/110: 58% fury momentum, prepared
5:52.080 demons_bite Fluffy_Pillow 28.0/110: 25% fury momentum
5:53.439 chaos_strike Fluffy_Pillow 49.0/110: 45% fury momentum
5:54.799 demons_bite Fluffy_Pillow 9.0/110: 8% fury
5:56.158 demons_bite Fluffy_Pillow 34.0/110: 31% fury
5:57.519 demons_bite Fluffy_Pillow 56.0/110: 51% fury
5:58.878 chaos_strike Fluffy_Pillow 85.0/110: 77% fury
6:00.236 demons_bite Fluffy_Pillow 45.0/110: 41% fury
6:01.598 use_item_vindictive_gladiators_badge_of_conquest Fluffy_Pillow 67.0/110: 61% fury
6:01.598 vengeful_retreat Fluffy_Pillow 67.0/110: 61% fury rapid_adaptation
6:01.598 fel_barrage Fluffy_Pillow 67.0/110: 61% fury momentum, prepared, vengeful_retreat_movement, rapid_adaptation
6:03.295 throw_glaive Fluffy_Pillow 79.0/110: 72% fury momentum, prepared, rapid_adaptation
6:04.657 throw_glaive Fluffy_Pillow 91.0/110: 83% fury raid_movement, momentum, prepared, rapid_adaptation
6:06.016 auto_attack Fluffy_Pillow 99.0/110: 90% fury prepared, rapid_adaptation
6:06.016 fury_of_the_illidari Fluffy_Pillow 99.0/110: 90% fury prepared, rapid_adaptation
6:07.376 eye_beam Fluffy_Pillow 107.0/110: 97% fury rage_of_the_illidari, rapid_adaptation
6:09.479 auto_attack Fluffy_Pillow 57.0/110: 52% fury rapid_adaptation
6:09.479 fel_rush Fluffy_Pillow 57.0/110: 52% fury rapid_adaptation
6:09.854 chaos_strike Fluffy_Pillow 82.0/110: 75% fury momentum, rapid_adaptation
6:11.212 chaos_strike Fluffy_Pillow 42.0/110: 38% fury momentum, rapid_adaptation
6:12.573 demons_bite Fluffy_Pillow 2.0/110: 2% fury momentum, rapid_adaptation
6:13.931 demons_bite Fluffy_Pillow 25.0/110: 23% fury rapid_adaptation
6:15.291 demons_bite Fluffy_Pillow 53.0/110: 48% fury rapid_adaptation
6:16.650 vengeful_retreat Fluffy_Pillow 80.0/110: 73% fury rapid_adaptation
6:16.650 throw_glaive Fluffy_Pillow 80.0/110: 73% fury momentum, prepared, vengeful_retreat_movement, rapid_adaptation
6:18.009 chaos_strike Fluffy_Pillow 88.0/110: 80% fury momentum, prepared, rapid_adaptation
6:19.369 chaos_strike Fluffy_Pillow 60.0/110: 55% fury momentum, prepared, rapid_adaptation
6:20.728 fel_rush Fluffy_Pillow 32.0/110: 29% fury raid_movement, prepared, rapid_adaptation
6:21.115 auto_attack Fluffy_Pillow 57.0/110: 52% fury momentum, prepared, rapid_adaptation
6:21.115 chaos_strike Fluffy_Pillow 57.0/110: 52% fury momentum, prepared, rapid_adaptation
6:22.474 throw_glaive Fluffy_Pillow 25.0/110: 23% fury momentum
6:23.832 demons_bite Fluffy_Pillow 25.0/110: 23% fury momentum
6:25.191 fel_rush Fluffy_Pillow 54.0/110: 49% fury
6:25.622 chaos_strike Fluffy_Pillow 79.0/110: 72% fury momentum
6:26.982 chaos_strike Fluffy_Pillow 59.0/110: 54% fury momentum
6:28.342 demons_bite Fluffy_Pillow 19.0/110: 17% fury momentum
6:29.702 demons_bite Fluffy_Pillow 43.0/110: 39% fury
6:31.061 demons_bite Fluffy_Pillow 72.0/110: 65% fury
6:32.421 vengeful_retreat Fluffy_Pillow 102.0/110: 93% fury
6:32.421 throw_glaive Fluffy_Pillow 102.0/110: 93% fury momentum, prepared, vengeful_retreat_movement
6:33.780 chaos_strike Fluffy_Pillow 110.0/110: 100% fury momentum, prepared
6:35.140 chaos_strike Fluffy_Pillow 82.0/110: 75% fury momentum, prepared

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8803 8478 0
Agility 25645 23939 13768 (6939)
Stamina 32379 32379 20668
Intellect 5328 5003 0
Spirit 2 2 0
Health 1942740 1942740 0
Fury 110 110 0
Crit 35.97% 34.89% 6613
Haste 10.67% 10.67% 3467
Damage / Heal Versatility 6.62% 6.62% 2646
Attack Power 25645 23939 0
Mastery 23.08% 23.08% 5278
Armor 2073 2073 2073
Run Speed 9 0 333

Gear

Source Slot Average Item Level: 857.00
Local Head Raddon's Cascading Eyes
ilevel: 895, stats: { 311 Armor, +2959 Sta, +1973 Agi, +882 Crit, +662 Haste }
Local Neck Blackened Portalstone Necklace
ilevel: 850, stats: { +1094 Sta, +1206 Crit, +629 Haste }, gems: { +150 Crit }, enchant: { +75 Crit }
Local Shoulders Swordsinger's Shoulders
ilevel: 840, stats: { 239 Armor, +886 AgiInt, +1329 Sta, +639 Mastery, +303 Haste }
Local Shirt Ebon Filigreed Doublet
ilevel: 1
Local Chest Vest of the Shattered Abyss
ilevel: 840, stats: { 318 Armor, +1772 Sta, +1182 Agi, +899 Haste, +359 Mastery }
Local Waist Dreadhide Girdle
ilevel: 865, stats: { 195 Armor, +1119 AgiInt, +1678 Sta, +606 Crit, +429 Haste }
Local Legs Brinewashed Leather Pants
ilevel: 850, stats: { 288 Armor, +1297 AgiInt, +1945 Sta, +820 Mastery, +484 Vers }
Local Feet Mana-Tanned Sandals
ilevel: 860, stats: { 234 Armor, +1601 Sta, +1068 AgiInt, +704 Mastery, +311 Crit }
Local Wrists Wax-Sealed Leather Bracers
ilevel: 860, stats: { 149 Armor, +1201 Sta, +801 AgiInt, +545 Haste, +218 Crit }
Local Hands Reluctant Partisan Gloves
ilevel: 845, stats: { 202 Armor, +929 AgiInt, +1393 Sta, +481 Mastery, +481 Crit }
Local Finger1 Ring of Deep Sea Pearls
ilevel: 870, stats: { +1319 Sta, +1244 Mastery, +735 Vers }, enchant: { +200 Crit }
Local Finger2 Dingy Suramar Mercantile Signet
ilevel: 860, stats: { +1201 Sta, +1362 Crit, +545 Vers }, enchant: { +200 Crit }
Local Trinket1 Nightborne's Hunting Horn
ilevel: 835, stats: { +1073 Agi, +882 Vers }
Local Trinket2 Vindictive Gladiator's Badge of Conquest
ilevel: 840, stats: { +1123 Agi }
Local Back Gossamer-Spun Greatcloak
ilevel: 865, stats: { 137 Armor, +839 StrAgiInt, +1258 Sta, +455 Mastery, +322 Crit, +333 RunSpeed }, enchant: { +200 Agi }
Local Main Hand Twinblades of the Deceiver
ilevel: 865, weapon: { 3789 - 7038, 2.6 }, stats: { +639 Agi, +959 Sta, +300 Crit, +288 Mastery }, relics: { +39 ilevels, +40 ilevels, +36 ilevels }
Local Off Hand Twinblades of the Deceiver
ilevel: 865, weapon: { 3789 - 7038, 2.6 }, stats: { +639 Agi, +959 Sta, +300 Crit, +288 Mastery }
Local Tabard Renowned Guild Tabard
ilevel: 1

Talents

Level
15 Fel Mastery (Havoc Demon Hunter) Chaos Cleave (Havoc Demon Hunter) Blind Fury (Havoc Demon Hunter)
30 Prepared (Havoc Demon Hunter) Demon Blades (Havoc Demon Hunter) Demonic Appetite (Havoc Demon Hunter)
45 Felblade First Blood (Havoc Demon Hunter) Bloodlet (Havoc Demon Hunter)
60 Netherwalk (Havoc Demon Hunter) Desperate Instincts (Havoc Demon Hunter) Soul Rending (Havoc Demon Hunter)
75 Momentum (Havoc Demon Hunter) Fel Eruption (Havoc Demon Hunter) Nemesis (Havoc Demon Hunter)
90 Master of the Glaive (Havoc Demon Hunter) Unleashed Power (Havoc Demon Hunter) Demon Reborn (Havoc Demon Hunter)
100 Chaos Blades (Havoc Demon Hunter) Fel Barrage (Havoc Demon Hunter) Demonic (Havoc Demon Hunter)

Profile

demonhunter="Mortwraith"
origin="https://us.api.battle.net/wow/character/thrall/Mortwraith/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/4/157250820-avatar.jpg"
level=110
race=blood_elf
role=attack
position=back
professions=alchemy=4/herbalism=80
talents=1133112
talent_override=fel_barrage,if=active_enemies>1|raid_event.adds.exists
artifact=3:0:0:0:0:1001:3:1002:3:1003:3:1005:3:1006:3:1010:1:1011:1:1012:1:1013:1:1015:1:1016:1:1330:1
spec=havoc

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war
actions.precombat+=/metamorphosis

# Executed every time the actor is available.
actions=auto_attack
# "Getting ready to use meta" conditions, this is used in a few places.
actions+=/variable,name=pooling_for_meta,value=cooldown.metamorphosis.ready&buff.metamorphosis.down&(!talent.demonic.enabled|!cooldown.eye_beam.ready)&(!talent.chaos_blades.enabled|cooldown.chaos_blades.ready)&(!talent.nemesis.enabled|debuff.nemesis.up|cooldown.nemesis.ready)
# Blade Dance conditions. Always if First Blood is talented, otherwise 3+ targets with Chaos Cleave or 2+ targets without.
actions+=/variable,name=blade_dance,value=talent.first_blood.enabled|spell_targets.blade_dance1>=2+talent.chaos_cleave.enabled
# Blade Dance pooling condition, so we don't spend too much fury when we need it soon. No need to pool on
# single target since First Blood already makes it cheap enough and delaying it a tiny bit isn't a big deal.
actions+=/variable,name=pooling_for_blade_dance,value=variable.blade_dance&fury-40<35-talent.first_blood.enabled*20&spell_targets.blade_dance1>=2
actions+=/blur,if=artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
actions+=/call_action_list,name=cooldown
# Fel Rush in at the start of combat.
actions+=/fel_rush,animation_cancel=1,if=time=0
actions+=/pick_up_fragment,if=talent.demonic_appetite.enabled&fury.deficit>=30
actions+=/consume_magic
# Vengeful Retreat backwards through the target to minimize downtime.
actions+=/vengeful_retreat,if=(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
# Fel Rush for Momentum and for fury from Fel Mastery.
actions+=/fel_rush,animation_cancel=1,if=(talent.momentum.enabled|talent.fel_mastery.enabled)&(!talent.momentum.enabled|(charges=2|cooldown.vengeful_retreat.remains>4)&buff.momentum.down)&(!talent.fel_mastery.enabled|fury.deficit>=25)&(charges=2|(raid_event.movement.in>10&raid_event.adds.in>10))
# Use Fel Barrage at max charges, saving it for Momentum and adds if possible.
actions+=/fel_barrage,if=charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
actions+=/throw_glaive,if=talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
actions+=/fury_of_the_illidari,if=active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
actions+=/eye_beam,if=talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
actions+=/death_sweep,if=variable.blade_dance
actions+=/blade_dance,if=variable.blade_dance
actions+=/throw_glaive,if=talent.bloodlet.enabled&spell_targets>=2+talent.chaos_cleave.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&(spell_targets>=3|raid_event.adds.in>recharge_time+cooldown)
actions+=/fel_eruption
actions+=/felblade,if=fury.deficit>=30+buff.prepared.up*8
actions+=/annihilation,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
actions+=/throw_glaive,if=talent.bloodlet.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&raid_event.adds.in>recharge_time+cooldown
actions+=/eye_beam,if=!talent.demonic.enabled&((spell_targets.eye_beam_tick>desired_targets&active_enemies>1)|(raid_event.adds.in>45&!variable.pooling_for_meta&buff.metamorphosis.down&(artifact.anguish_of_the_deceiver.enabled|active_enemies>1)))
# If Demonic is talented, pool fury as Eye Beam is coming off cooldown.
actions+=/demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<gcd&fury.deficit>=20
actions+=/demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<2*gcd&fury.deficit>=45
actions+=/throw_glaive,if=buff.metamorphosis.down&spell_targets>=2
actions+=/chaos_strike,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
# Use Fel Barrage if its nearing max charges, saving it for Momentum and adds if possible.
actions+=/fel_barrage,if=charges=4&buff.metamorphosis.down&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
actions+=/fel_rush,animation_cancel=1,if=!talent.momentum.enabled&raid_event.movement.in>charges*10
actions+=/demons_bite
actions+=/throw_glaive,if=buff.out_of_range.up|buff.raid_movement.up
actions+=/felblade,if=movement.distance|buff.out_of_range.up
actions+=/fel_rush,if=movement.distance>15|(buff.out_of_range.up&!talent.momentum.enabled)
actions+=/vengeful_retreat,if=movement.distance>15

actions.cooldown=use_item,slot=trinket2,if=buff.chaos_blades.up|!talent.chaos_blades.enabled
actions.cooldown+=/nemesis,target_if=min:target.time_to_die,if=raid_event.adds.exists&debuff.nemesis.down&(active_enemies>desired_targets|raid_event.adds.in>60)
actions.cooldown+=/nemesis,if=!raid_event.adds.exists&(cooldown.metamorphosis.remains>100|target.time_to_die<70)
actions.cooldown+=/nemesis,sync=metamorphosis,if=!raid_event.adds.exists
actions.cooldown+=/chaos_blades,if=buff.metamorphosis.up|cooldown.metamorphosis.remains>100|target.time_to_die<20
actions.cooldown+=/metamorphosis,if=variable.pooling_for_meta&fury.deficit<30&(talent.chaos_blades.enabled|!cooldown.fury_of_the_illidari.ready)
actions.cooldown+=/potion,name=old_war,if=buff.metamorphosis.remains>25|target.time_to_die<30

head=raddons_cascading_eyes,id=137061,bonus_id=1811
neck=blackened_portalstone_necklace,id=139332,bonus_id=1807/1808/1472,gems=150crit,enchant=75crit
shoulders=swordsingers_shoulders,id=134286,bonus_id=1727/1502/1813
back=gossamerspun_greatcloak,id=138221,bonus_id=1807/42/1487/3337,enchant=200agi
chest=vest_of_the_shattered_abyss,id=139715,bonus_id=3385/3384
shirt=ebon_filigreed_doublet,id=42360
tabard=renowned_guild_tabard,id=69210
wrists=waxsealed_leather_bracers,id=141429,bonus_id=3466/1472
hands=reluctant_partisan_gloves,id=139940,bonus_id=3474/1507/1674
waist=dreadhide_girdle,id=121299,bonus_id=3432/1527/3337
legs=brinewashed_leather_pants,id=134238,bonus_id=3397/1512/3337
feet=manatanned_sandals,id=141430,bonus_id=1472
finger1=ring_of_deep_sea_pearls,id=141545,bonus_id=1482/3336,enchant=200crit
finger2=dingy_suramar_mercantile_signet,id=141492,bonus_id=1472,enchant=200crit
trinket1=nightbornes_hunting_horn,id=134291,bonus_id=3432/607/1497/1674
trinket2=vindictive_gladiators_badge_of_conquest,id=135804,bonus_id=3428/1472
main_hand=twinblades_of_the_deceiver,id=127829,bonus_id=719,gem_id=141255/136719/142058/0,relic_id=3432:1497:1674/1727:1492:1813/0/0
off_hand=twinblades_of_the_deceiver,id=127830

# Gear Summary
# gear_ilvl=856.56
# gear_agility=13768
# gear_stamina=20668
# gear_crit_rating=6613
# gear_haste_rating=3467
# gear_mastery_rating=5278
# gear_versatility_rating=2646
# gear_speed_rating=333
# gear_armor=2073

Táunks

Táunks : 455606 dps, 196447 dps to main target

  • Race: Blood Elf
  • Class: Demonhunter
  • Spec: Havoc
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
455605.6 455605.6 731.2 / 0.160% 136475.0 / 30.0% 42074.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
10.7 10.7 Fury 39.23% 40.9 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Táunks/advanced
Talents
  • 15: Fel Mastery (Havoc Demon Hunter)
  • 30: Demon Blades (Havoc Demon Hunter)
  • 45: Bloodlet (Havoc Demon Hunter)
  • 60: Soul Rending (Havoc Demon Hunter)
  • 75: Momentum (Havoc Demon Hunter)
  • 90: Master of the Glaive (Havoc Demon Hunter)
  • 100: Fel Barrage (Havoc Demon Hunter)
  • Talent Calculator
Artifact
Professions
  • skinning: 800
Scale Factors for Táunks Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 15.94 11.35 9.91 9.21 6.60
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.93 0.92 0.91 0.92 0.92
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit ~= Haste > Mastery
Pawn string ( Pawn: v1: "Táunks": Agility=15.94, CritRating=9.91, HasteRating=9.21, MasteryRating=6.60, Versatility=11.35 )

Scale Factors for other metrics

Scale Factors for Táunks Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 15.94 11.35 9.91 9.21 6.60
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.93 0.92 0.91 0.92 0.92
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit ~= Haste > Mastery
Pawn string ( Pawn: v1: "Táunks": Agility=15.94, CritRating=9.91, HasteRating=9.21, MasteryRating=6.60, Versatility=11.35 )
Scale Factors for Táunks Priority Target Damage Per Second
Agi Crit Vers Haste Mastery
Scale Factors 6.28 4.97 4.83 4.43 2.57
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.18 0.18 0.18 0.18 0.18
Gear Ranking
Optimizers
Ranking
  • Agi > Crit ~= Vers > Haste > Mastery
Pawn string ( Pawn: v1: "Táunks": Agility=6.28, CritRating=4.97, HasteRating=4.43, MasteryRating=2.57, Versatility=4.83 )
Scale Factors for Táunks Damage Per Second (Effective)
Agi Vers Crit Haste Mastery
Scale Factors 15.94 11.35 9.91 9.21 6.60
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Haste > Mastery
Pawn string ( Pawn: v1: "Táunks": Agility=15.94, CritRating=9.91, HasteRating=9.21, MasteryRating=6.60, Versatility=11.35 )
Scale Factors for Táunks Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Táunks Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Táunks Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Táunks Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Táunks Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Táunks Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Táunks Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for TáunksTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Táunks 455606
Annihilation 13051 2.8% 15.1 19.88sec 342214 372900 Direct 30.1 116563 261018 171110 37.8% 0.0%  

Stats details: annihilation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.07 30.15 0.00 0.00 0.9177 0.0000 5158701.15 5158701.15 0.00 372900.18 372900.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.76 62.24% 116563.49 95053 142380 116579.05 106852 128222 2187324 2187324 0.00
crit 11.38 37.76% 261017.84 212919 318932 260311.62 0 287217 2971377 2971377 0.00
 
 

Action details: annihilation

Static Values
  • id:201427
  • school:chaos
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
Spelldata
  • id:201427
  • name:Annihilation
  • school:chaos
  • tooltip:
  • description:Slice your target for ${$227518sw1+$201428sw1} Chaos damage. Critical strikes refund {$197125s1=20} Fury.
 
auto_attack_mh 7967 1.8% 144.2 2.77sec 22150 10968 Direct 144.2 18657 37315 22150 37.7% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 144.24 144.24 0.00 0.00 2.0195 0.0000 3194928.26 4696847.18 31.98 10968.17 10968.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.52 43.35% 18656.52 16963 20356 18656.18 17910 19332 1166443 1714782 31.98
crit 54.36 37.69% 37314.75 33927 40712 37315.28 35713 39016 2028485 2982065 31.98
miss 27.36 18.97% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 3985 0.9% 144.2 2.77sec 11080 5489 Direct 144.2 9328 18655 11080 37.7% 18.9%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 144.25 144.25 0.00 0.00 2.0187 0.0000 1598309.51 2349666.37 31.98 5488.91 5488.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.49 43.32% 9327.67 8482 10178 9327.90 8957 9698 582887 856900 31.98
crit 54.43 37.73% 18655.44 16963 20356 18655.57 17752 19418 1015422 1492767 31.98
miss 27.33 18.94% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Blade Dance 46234 10.1% 19.5 14.76sec 939213 734280 Direct 445.3 29804 59596 41026 37.7% 0.0%  

Stats details: blade_dance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.45 445.34 0.00 0.00 1.2791 0.0000 18270364.74 26859166.78 31.98 734280.39 734280.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 277.60 62.33% 29804.50 15781 65084 29810.20 26612 33394 8273695 12163115 31.98
crit 167.74 37.67% 59595.66 31561 130167 59606.17 50418 69283 9996670 14696052 31.98
 
 

Action details: blade_dance

Static Values
  • id:188499
  • school:physical
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.blade_dance
Spelldata
  • id:188499
  • name:Blade Dance
  • school:physical
  • tooltip:Dodge chance increased by {$s2=100}%.
  • description:Strike all nearby enemies for ${$sw2+2*$199552sw2+$200685sw2} Physical damage, and increase your chance to dodge by {$s2=100}% for {$d=1 second}.
 
Chaos Strike 40663 9.1% 62.1 5.87sec 265283 204627 Direct 124.1 90500 202687 132731 37.6% 0.0%  

Stats details: chaos_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.10 124.13 0.00 0.00 1.2964 0.0000 16475366.07 16475366.07 0.00 204627.35 204627.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.40 62.36% 90499.73 73118 109677 90465.03 85664 94964 7004624 7004624 0.00
crit 46.73 37.64% 202687.13 163784 245676 202619.44 184257 215785 9470742 9470742 0.00
 
 

Action details: chaos_strike

Static Values
  • id:162794
  • school:chaos
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
Spelldata
  • id:162794
  • name:Chaos Strike
  • school:chaos
  • tooltip:
  • description:Slice your target for ${$222031sw1+$199547sw1} Chaos damage. Critical strikes refund {$197125s1=20} Fury.
 
Death Sweep 16904 3.7% 4.9 64.01sec 1364795 1405366 Direct 110.4 43932 87875 60479 37.7% 0.0%  

Stats details: death_sweep

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.89 110.44 0.00 0.00 0.9712 0.0000 6679702.43 9819795.30 31.98 1405365.54 1405365.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 68.85 62.34% 43932.32 23507 96948 44004.71 33070 54533 3024892 4446878 31.98
crit 41.59 37.66% 87874.59 47013 193895 88022.88 60959 132341 3654810 5372917 31.98
 
 

Action details: death_sweep

Static Values
  • id:210152
  • school:physical
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.blade_dance
Spelldata
  • id:210152
  • name:Death Sweep
  • school:physical
  • tooltip:Dodge chance increased by {$s3=0}%.
  • description:Strike all nearby enemies for ${3*$210153sw2+$210155sw2} Physical damage, and increase your Dodge chance by {$s2=100}% for {$d=1 second}.
 
Demon Blades 15367 3.4% 174.5 4.90sec 35319 0 Direct 174.5 25657 51323 35319 37.6% 0.0%  

Stats details: demon_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 174.50 174.50 0.00 0.00 0.0000 0.0000 6163311.72 6163311.72 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 108.81 62.35% 25656.77 23532 28239 25658.69 24709 26750 2791771 2791771 0.00
crit 65.69 37.65% 51322.82 47064 56477 51325.94 48913 53810 3371541 3371541 0.00
 
 

Action details: demon_blades

Static Values
  • id:203796
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:203796
  • name:Demon Blades
  • school:shadow
  • tooltip:
  • description:Inflicts $sw1 Shadow damage and generates $m3 to $M3 Fury.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.85
 
Eye Beam 36295 (50498) 7.9% (11.1%) 7.3 55.14sec 2745534 1498129 Periodic 312.3 0 46088 46088 100.0% 0.0% 2.8%

Stats details: eye_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.29 0.00 69.96 312.33 1.8327 0.1617 14394320.84 14394320.84 0.00 1498128.51 1498128.51
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 312.3 100.00% 46087.58 41304 49565 46082.73 41304 49565 14394321 14394321 0.00
 
 

Action details: eye_beam

Static Values
  • id:198013
  • school:chaos
  • resource:fury
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
Spelldata
  • id:198013
  • name:Eye Beam
  • school:chromatic
  • tooltip:
  • description:Blasts all enemies directly in front of you for $<dmg> Chaos damage. Eye Beam always critically strikes.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:2.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Anguish 14203 3.1% 0.0 0.00sec 0 0 Direct 30.8 133084 266215 183160 37.6% 0.0%  

Stats details: anguish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 30.76 0.00 0.00 0.0000 0.0000 5634159.21 5634159.21 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.19 62.39% 133084.12 12728 152732 133068.16 70676 152732 2553957 2553957 0.00
crit 11.57 37.61% 266215.09 25455 305463 266138.75 147940 305463 3080202 3080202 0.00
 
 

Action details: anguish

Static Values
  • id:202446
  • school:chaos
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202446
  • name:Anguish
  • school:chaos
  • tooltip:
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals {$202446s1=10} Chaos damage to the victim per application.}
 
Fel Barrage 38827 8.5% 9.1 46.10sec 1683723 1140730 Direct 138.2 80624 161217 110960 37.6% 0.0%  

Stats details: fel_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.10 138.15 43.97 0.00 1.4760 0.1982 15329134.19 15329134.19 0.00 1140730.33 1140730.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 86.15 62.36% 80624.20 63638 95457 80657.58 0 95457 6945653 6945653 0.00
crit 52.00 37.64% 161216.77 127276 190915 161248.16 0 190915 8383481 8383481 0.00
 
 

Action details: fel_barrage

Static Values
  • id:211053
  • school:chaos
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Spelldata
  • id:211053
  • name:Fel Barrage
  • school:magic
  • tooltip:Unleashing Fel.
  • description:At your command, unleash Fel, inflicting ${{$211052s1=0}} Chaos damage to your target and nearby enemies for each charge. Max 5 charges. Your damaging abilities have a chance to generate a charge.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:1.00
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Fel Rush 63272 13.9% 38.6 10.51sec 649796 1608617 Direct 148.6 122701 245409 168899 37.6% 0.0%  

Stats details: fel_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.62 148.60 0.00 0.00 0.4040 0.0000 25097638.34 25097638.34 0.00 1608616.74 1608616.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 92.65 62.35% 122700.68 121613 145935 122709.90 121613 126535 11368389 11368389 0.00
crit 55.94 37.65% 245408.81 243225 291870 245418.10 243225 255090 13729249 13729249 0.00
 
 

Action details: fel_rush

Static Values
  • id:195072
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.2500
  • min_gcd:0.2500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time=0
Spelldata
  • id:195072
  • name:Fel Rush
  • school:physical
  • tooltip:
  • description:Rush forward, incinerating anything in your path for {$192611s1=0} Chaos damage.$?a192939[ |cFFFFFFFFGenerates {$192939s1=25} Fury if you damage an enemy.|r][]
 
Fury of the Illidari 42062 9.2% 7.1 60.35sec 2350247 1916686 Periodic 448.3 27002 54011 37175 37.7% 0.0% 5.3%

Stats details: fury_of_the_illidari

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.09 0.00 49.47 448.35 1.2263 0.4283 16667502.69 16667502.69 0.00 557684.03 1916686.14
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 279.5 62.33% 27001.60 16184 38842 27003.20 24912 29695 7546199 7546199 0.00
crit 168.9 37.67% 54011.30 32368 77684 54014.58 48513 61366 9121304 9121304 0.00
 
 

Action details: fury_of_the_illidari

Static Values
  • id:201467
  • school:chaos
  • resource:none
  • range:5.0
  • travel_speed:3.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
Spelldata
  • id:201467
  • name:Fury of the Illidari
  • school:physical
  • tooltip:
  • description:Throws the |cFFFFCC99Twinblades of the Deceiver|r in a whirlwind of energy, causing ${7*($201628sw1+$201789sw1)} Chaos damage over {$d=3 seconds} to all nearby enemies.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Inner Demons 11846 2.6% 6.5 56.66sec 724350 0 Direct 14.8 230805 461552 317922 37.7% 0.0%  

Stats details: inner_demons

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.51 14.83 0.00 0.00 0.0000 0.0000 4716206.34 4716206.34 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.23 62.25% 230804.53 206824 248189 230095.85 0 248189 2131457 2131457 0.00
crit 5.60 37.75% 461551.50 413648 496378 453460.90 0 496378 2584749 2584749 0.00
 
 

Action details: inner_demons

Static Values
  • id:202388
  • school:chaos
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202388
  • name:Inner Demons
  • school:chaos
  • tooltip:
  • description:{$@spelldesc201471=Chaos Strike has a chance to unleash your inner demon, causing it to crash into your target and deal {$202388s1=0} Chaos damage to all nearby enemies.}
 
Metamorphosis (_impact) 1208 0.3% 2.0 244.58sec 238233 0 Direct 5.0 69171 138439 95547 38.1% 0.0%  

Stats details: metamorphosis_impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 4.99 0.00 0.00 0.0000 0.0000 476823.74 476823.74 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.09 61.92% 69170.96 63638 76366 64329.69 0 76366 213725 213725 0.00
crit 1.90 38.08% 138438.93 127276 152732 113551.02 0 152732 263099 263099 0.00
 
 

Action details: metamorphosis_impact

Static Values
  • id:200166
  • school:chaos
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:200166
  • name:Metamorphosis
  • school:chromatic
  • tooltip:Stunned.
  • description:{$@spelldesc191427=Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.}
 
Potion of the Old War 10973 2.4% 23.7 12.55sec 183328 0 Direct 23.7 133141 266219 183325 37.7% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.65 23.65 0.00 0.00 0.0000 0.0000 4336239.71 6374683.11 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.73 62.29% 133140.60 118232 141878 133123.12 122961 141878 1961534 2883641 31.98
crit 8.92 37.71% 266219.06 236464 283756 266182.97 236464 283756 2374706 3491042 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Throw Glaive 40289 (89649) 8.8% (19.7%) 50.6 7.96sec 705510 583644 Direct 114.8 101363 202714 139509 37.6% 0.0%  

Stats details: throw_glaive

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.56 114.81 0.00 0.00 1.2088 0.0000 16017170.91 23546758.42 31.98 583644.17 583644.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.60 62.36% 101363.13 89931 107917 101355.70 96426 105669 7257582 10669333 31.98
crit 43.21 37.64% 202713.96 179862 215835 202697.27 187241 213266 8759589 12877426 31.98
 
 

Action details: throw_glaive

Static Values
  • id:185123
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
Spelldata
  • id:185123
  • name:Throw Glaive
  • school:physical
  • tooltip:
  • description:Throw a demonic glaive at the target, dealing $sw1 Physical damage. The glaive can ricochet to ${$x1-1} additional enemies within 10 yards.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.90
 
    Bloodlet 49360 10.9% 0.0 0.00sec 0 0 Periodic 360.6 54494 0 54494 0.0% 0.0% 179.8%

Stats details: bloodlet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 360.59 360.59 0.0000 2.0000 19649907.80 19649907.80 0.00 27246.70 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 360.6 100.00% 54493.62 26979 140143 54499.34 46532 64107 19649908 19649908 0.00
 
 

Action details: bloodlet

Static Values
  • id:207690
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207690
  • name:Bloodlet
  • school:physical
  • tooltip:Inflicts $w1 damage every $t1 sec.
  • description:{$@spelldesc206473=Throw Glaive causes targets to bleed for {$s1=150}% of the damage inflicted over {$207690d=10 seconds}. If this effect is reapplied, any remaining damage will be added to the new Bloodlet.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Vengeful Retreat 3100 0.7% 15.9 25.79sec 77333 0 Direct 56.0 15959 31919 21980 37.7% 0.0%  

Stats details: vengeful_retreat

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.91 55.97 0.00 0.00 0.0000 0.0000 1230160.59 1808452.60 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.85 62.27% 15959.40 15959 15959 15959.40 15959 15959 556230 817710 31.98
crit 21.11 37.73% 31918.81 31919 31919 31918.81 31919 31919 673931 990742 31.98
 
 

Action details: vengeful_retreat

Static Values
  • id:198793
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:25.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
Spelldata
  • id:198793
  • name:Vengeful Retreat
  • school:physical
  • tooltip:
  • description:Remove all snares and vault away. Nearby enemies take $198813sw2 Physical damage and have their movement speed reduced by {$198813s1=70}% for {$198813d=3 seconds}.$?a203551[ |cFFFFFFFFGenerates $203650o1 Fury over {$203650d=5 seconds} if you damage an enemy.|r][]
 
Simple Action Stats Execute Interval
Táunks
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Táunks
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Táunks
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Táunks
  • harmful:false
  • if_expr:
 
Metamorphosis 1.0 244.58sec

Stats details: metamorphosis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.1278 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: metamorphosis

Static Values
  • id:191427
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:240.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191427
  • name:Metamorphosis
  • school:physical
  • tooltip:
  • description:Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blade Dance 19.5 0.0 14.7sec 14.7sec 4.92% 4.92% 0.0(0.0) 19.5

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_blade_dance
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • blade_dance_1:4.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188499
  • name:Blade Dance
  • tooltip:Dodge chance increased by {$s2=100}%.
  • description:Strike all nearby enemies for ${$sw2+2*$199552sw2+$200685sw2} Physical damage, and increase your chance to dodge by {$s2=100}% for {$d=1 second}.
  • max_stacks:0
  • duration:1.00
  • cooldown:10.00
  • default_chance:0.00%
Blood Frenzy 14.2 8.6 28.3sec 17.3sec 45.51% 45.51% 8.6(8.6) 13.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2743.21

Stack Uptimes

  • blood_frenzy_1:45.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your ranged and melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.12% 12.59% 0.0(0.0) 1.0

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Death Sweep 4.9 0.0 64.5sec 64.5sec 1.24% 1.24% 0.0(0.0) 4.9

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_death_sweep
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • death_sweep_1:1.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210152
  • name:Death Sweep
  • tooltip:Dodge chance increased by {$s3=0}%.
  • description:Strike all nearby enemies for ${3*$210153sw2+$210155sw2} Physical damage, and increase your Dodge chance by {$s2=100}% for {$d=1 second}.
  • max_stacks:0
  • duration:1.00
  • cooldown:8.00
  • default_chance:0.00%
fel_rush_movement 1.8 0.0 119.3sec 119.3sec 0.11% 0.11% 0.0(0.0) 1.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_fel_rush_movement
  • max_stacks:1
  • duration:0.25
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • fel_rush_movement_1:0.11%

Trigger Attempt Success

  • trigger_pct:95.59%
Metamorphosis 8.0 0.4 54.2sec 49.7sec 18.18% 19.98% 0.4(0.4) 7.9

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_metamorphosis
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • metamorphosis_1:18.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162264
  • name:Metamorphosis
  • tooltip:Chaos Strike and Blade Dance upgraded to $@spellname201427 and $@spellname210152. Haste increased by {$s7=25}%.
  • description:{$@spelldesc191427=Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Momentum 53.4 1.1 7.6sec 7.5sec 53.54% 59.54% 1.1(1.1) 52.9

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_momentum
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • momentum_1:53.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:208628
  • name:Momentum
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Increases all damage done by {$s1=20}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
out_of_range 16.7 16.7 24.5sec 11.9sec 1.45% 1.45% 16.7(16.7) 0.0

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_out_of_range
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • out_of_range_1:1.45%

Trigger Attempt Success

  • trigger_pct:100.00%
Potion of the Old War 2.0 0.0 250.2sec 0.0sec 12.15% 12.15% 0.0(0.0) 2.0

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 10.43% 10.43% 2.0(2.0) 0.0

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:10.43%

Trigger Attempt Success

  • trigger_pct:100.00%
vengeful_retreat_movement 15.9 0.0 25.8sec 25.8sec 3.96% 3.96% 0.0(0.0) 15.9

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_vengeful_retreat_movement
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vengeful_retreat_movement_1:3.96%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Táunks
annihilation Fury 15.1 603.0 40.0 40.0 8555.5
blade_dance Fury 19.5 680.8 35.0 35.0 26834.9
chaos_strike Fury 62.1 2484.2 40.0 40.0 6632.1
death_sweep Fury 4.9 171.3 35.0 35.0 38991.4
eye_beam Fury 7.3 364.7 50.0 50.0 54910.8
Resource Gains Type Count Total Average Overflow
demon_blades Fury 174.50 2785.36 (64.30%) 15.96 7.02 0.25%
fel_rush_dmg Fury 38.62 965.46 (22.29%) 25.00 0.14 0.01%
annihilation Fury 5.69 113.84 (2.63%) 20.00 0.00 0.00%
chaos_strike Fury 23.34 466.89 (10.78%) 20.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Fury 10.80 10.73
Combat End Resource Mean Min Max
Fury 27.90 0.00 120.00

Benefits & Uptimes

Benefits %
Uptimes %
Fury Cap 0.1%

Procs

Count Interval
delayed_swing__out_of_range 3.7 109.2sec
delayed_swing__channeling 11.6 69.1sec
demon_blades_wasted 0.0 7.0sec
fel_barrage 24.7 15.8sec

Statistics & Data Analysis

Fight Length
Sample Data Táunks Fight Length
Count 9999
Mean 401.00
Minimum 308.02
Maximum 501.87
Spread ( max - min ) 193.85
Range [ ( max - min ) / 2 * 100% ] 24.17%
DPS
Sample Data Táunks Damage Per Second
Count 9999
Mean 455605.55
Minimum 365472.51
Maximum 578314.74
Spread ( max - min ) 212842.23
Range [ ( max - min ) / 2 * 100% ] 23.36%
Standard Deviation 37306.3389
5th Percentile 401216.10
95th Percentile 521484.33
( 95th Percentile - 5th Percentile ) 120268.23
Mean Distribution
Standard Deviation 373.0820
95.00% Confidence Intervall ( 454874.33 - 456336.78 )
Normalized 95.00% Confidence Intervall ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 257
0.1% Error 25756
0.1 Scale Factor Error with Delta=300 11880888
0.05 Scale Factor Error with Delta=300 47523555
0.01 Scale Factor Error with Delta=300 1188088879
Priority Target DPS
Sample Data Táunks Priority Target Damage Per Second
Count 9999
Mean 196447.13
Minimum 171208.78
Maximum 227164.02
Spread ( max - min ) 55955.24
Range [ ( max - min ) / 2 * 100% ] 14.24%
Standard Deviation 7403.8127
5th Percentile 184537.01
95th Percentile 208908.76
( 95th Percentile - 5th Percentile ) 24371.75
Mean Distribution
Standard Deviation 74.0418
95.00% Confidence Intervall ( 196302.01 - 196592.25 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 54
0.1% Error 5456
0.1 Scale Factor Error with Delta=300 467944
0.05 Scale Factor Error with Delta=300 1871778
0.01 Scale Factor Error with Delta=300 46794468
DPS(e)
Sample Data Táunks Damage Per Second (Effective)
Count 9999
Mean 455605.55
Minimum 365472.51
Maximum 578314.74
Spread ( max - min ) 212842.23
Range [ ( max - min ) / 2 * 100% ] 23.36%
Damage
Sample Data Táunks Damage
Count 9999
Mean 181089948.23
Minimum 144567357.89
Maximum 213792266.80
Spread ( max - min ) 69224908.91
Range [ ( max - min ) / 2 * 100% ] 19.11%
DTPS
Sample Data Táunks Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Táunks Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Táunks Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Táunks Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Táunks Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Táunks Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data TáunksTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Táunks Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=old_war
5 0.00 metamorphosis
Default action list Executed every time the actor is available.
# count action,conditions
6 40.83 auto_attack
0.00 variable,name=pooling_for_meta,value=cooldown.metamorphosis.ready&buff.metamorphosis.down&(!talent.demonic.enabled|!cooldown.eye_beam.ready)&(!talent.chaos_blades.enabled|cooldown.chaos_blades.ready)&(!talent.nemesis.enabled|debuff.nemesis.up|cooldown.nemesis.ready)
"Getting ready to use meta" conditions, this is used in a few places.
0.00 variable,name=blade_dance,value=talent.first_blood.enabled|spell_targets.blade_dance1>=2+talent.chaos_cleave.enabled
Blade Dance conditions. Always if First Blood is talented, otherwise 3+ targets with Chaos Cleave or 2+ targets without.
0.00 variable,name=pooling_for_blade_dance,value=variable.blade_dance&fury-40<35-talent.first_blood.enabled*20&spell_targets.blade_dance1>=2
Blade Dance pooling condition, so we don't spend too much fury when we need it soon. No need to pool on # single target since First Blood already makes it cheap enough and delaying it a tiny bit isn't a big deal.
0.00 blur,if=artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
7 0.00 call_action_list,name=cooldown
8 1.00 fel_rush,animation_cancel=1,if=time=0
Fel Rush in at the start of combat.
0.00 pick_up_fragment,if=talent.demonic_appetite.enabled&fury.deficit>=30
0.00 consume_magic
9 16.10 vengeful_retreat,if=(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
Vengeful Retreat backwards through the target to minimize downtime.
A 35.83 fel_rush,animation_cancel=1,if=(talent.momentum.enabled|talent.fel_mastery.enabled)&(!talent.momentum.enabled|(charges=2|cooldown.vengeful_retreat.remains>4)&buff.momentum.down)&(!talent.fel_mastery.enabled|fury.deficit>=25)&(charges=2|(raid_event.movement.in>10&raid_event.adds.in>10))
Fel Rush for Momentum and for fury from Fel Mastery.
B 3.27 fel_barrage,if=charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Use Fel Barrage at max charges, saving it for Momentum and adds if possible.
C 2.29 throw_glaive,if=talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
D 7.12 fury_of_the_illidari,if=active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
0.00 eye_beam,if=talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
E 4.92 death_sweep,if=variable.blade_dance
F 19.50 blade_dance,if=variable.blade_dance
G 19.26 throw_glaive,if=talent.bloodlet.enabled&spell_targets>=2+talent.chaos_cleave.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&(spell_targets>=3|raid_event.adds.in>recharge_time+cooldown)
0.00 fel_eruption
0.00 felblade,if=fury.deficit>=30+buff.prepared.up*8
H 15.07 annihilation,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
I 10.89 throw_glaive,if=talent.bloodlet.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&raid_event.adds.in>recharge_time+cooldown
J 7.30 eye_beam,if=!talent.demonic.enabled&((spell_targets.eye_beam_tick>desired_targets&active_enemies>1)|(raid_event.adds.in>45&!variable.pooling_for_meta&buff.metamorphosis.down&(artifact.anguish_of_the_deceiver.enabled|active_enemies>1)))
0.00 demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<gcd&fury.deficit>=20
If Demonic is talented, pool fury as Eye Beam is coming off cooldown.
0.00 demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<2*gcd&fury.deficit>=45
K 10.84 throw_glaive,if=buff.metamorphosis.down&spell_targets>=2
L 62.11 chaos_strike,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
M 5.84 fel_barrage,if=charges=4&buff.metamorphosis.down&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Use Fel Barrage if its nearing max charges, saving it for Momentum and adds if possible.
0.00 fel_rush,animation_cancel=1,if=!talent.momentum.enabled&raid_event.movement.in>charges*10
0.00 demons_bite
N 7.43 throw_glaive,if=buff.out_of_range.up|buff.raid_movement.up
0.00 felblade,if=movement.distance|buff.out_of_range.up
O 1.80 fel_rush,if=movement.distance>15|(buff.out_of_range.up&!talent.momentum.enabled)
0.00 vengeful_retreat,if=movement.distance>15
actions.cooldown
# count action,conditions
0.00 nemesis,target_if=min:target.time_to_die,if=raid_event.adds.exists&debuff.nemesis.down&(active_enemies>desired_targets|raid_event.adds.in>60)
0.00 nemesis,if=!raid_event.adds.exists&(cooldown.metamorphosis.remains>100|target.time_to_die<70)
0.00 nemesis,sync=metamorphosis,if=!raid_event.adds.exists
0.00 chaos_blades,if=buff.metamorphosis.up|cooldown.metamorphosis.remains>100|target.time_to_die<20
P 1.00 metamorphosis,if=variable.pooling_for_meta&fury.deficit<30&(talent.chaos_blades.enabled|!cooldown.fury_of_the_illidari.ready)
Q 1.00 potion,name=old_war,if=buff.metamorphosis.remains>25|target.time_to_die<30

Sample Sequence

0124568B6CDI9HIHAHHN6HHHAGO6EGHJ6EN69M6FAGLLKLL6LLAG6F9GA6FDAGLFLN69OG6FM6JKA6FALGLLL9NL6A6FKFAMG6DL9LLLALLLL6AFCGAJFKL96BLFLALLKA6GAFG9FDK6ALLLLLK6K6AM9FKAJ6LLALLKK696AFGPQDEAGHB6HHHH9HG6GAEA6JGEKFLLL96NLALO6FGLF6KLDF9ILBAJ6AILLLLLN6ALI9LLALIA6LLLLJH9CI6DALLILLABI6LALL9ILLA

Sample Sequence Table

time name target resources buffs
Pre flask Táunks 0.0/120: 0% fury
Pre food Táunks 0.0/120: 0% fury
Pre augmentation Táunks 0.0/120: 0% fury
Pre potion Fluffy_Pillow 0.0/120: 0% fury potion_of_the_old_war
0:00.000 metamorphosis Fluffy_Pillow 0.0/120: 0% fury metamorphosis, potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 0.0/120: 0% fury metamorphosis, potion_of_the_old_war
0:00.000 fel_rush Fluffy_Pillow 0.0/120: 0% fury metamorphosis, blood_frenzy, potion_of_the_old_war
0:00.392 fel_barrage Fluffy_Pillow 25.0/120: 21% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:01.655 auto_attack Fluffy_Pillow 25.0/120: 21% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:01.655 throw_glaive Fluffy_Pillow 25.0/120: 21% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:02.431 fury_of_the_illidari Fluffy_Pillow 25.0/120: 21% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:03.204 throw_glaive Fluffy_Pillow 25.0/120: 21% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:03.979 Waiting 0.100 sec 25.0/120: 21% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:04.079 vengeful_retreat Fluffy_Pillow 25.0/120: 21% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:04.079 Waiting 0.800 sec 25.0/120: 21% fury bloodlust, metamorphosis, momentum, vengeful_retreat_movement, blood_frenzy, potion_of_the_old_war
0:04.879 annihilation Fluffy_Pillow 58.0/120: 48% fury bloodlust, metamorphosis, momentum, vengeful_retreat_movement, blood_frenzy, potion_of_the_old_war
0:05.652 Waiting 0.900 sec 18.0/120: 15% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:06.552 throw_glaive Fluffy_Pillow 33.0/120: 28% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:07.558 Waiting 1.300 sec 33.0/120: 28% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:08.858 annihilation Fluffy_Pillow 70.0/120: 58% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:09.631 Waiting 0.400 sec 30.0/120: 25% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:10.031 fel_rush Fluffy_Pillow 30.0/120: 25% fury bloodlust, metamorphosis, potion_of_the_old_war
0:10.442 annihilation Fluffy_Pillow 55.0/120: 46% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:11.273 Waiting 0.300 sec 15.0/120: 13% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:11.573 annihilation Fluffy_Pillow 43.0/120: 36% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:12.346 throw_glaive Fluffy_Pillow 3.0/120: 3% fury bloodlust, raid_movement, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:13.118 auto_attack Fluffy_Pillow 3.0/120: 3% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:13.118 Waiting 2.700 sec 3.0/120: 3% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:15.818 annihilation Fluffy_Pillow 52.0/120: 43% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:16.590 Waiting 1.900 sec 12.0/120: 10% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:18.490 annihilation Fluffy_Pillow 60.0/120: 50% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:19.264 annihilation Fluffy_Pillow 40.0/120: 33% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:20.039 fel_rush Fluffy_Pillow 20.0/120: 17% fury bloodlust, raid_movement, metamorphosis, blood_frenzy, potion_of_the_old_war
0:20.454 throw_glaive Fluffy_Pillow 45.0/120: 38% fury bloodlust, raid_movement, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:21.228 fel_rush Fluffy_Pillow 45.0/120: 38% fury bloodlust, raid_movement, metamorphosis, momentum, potion_of_the_old_war
0:21.665 Waiting 0.400 sec 70.0/120: 58% fury bloodlust, metamorphosis, momentum, out_of_range, potion_of_the_old_war
0:22.065 auto_attack Fluffy_Pillow 70.0/120: 58% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:22.065 death_sweep Fluffy_Pillow 70.0/120: 58% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:22.897 throw_glaive Fluffy_Pillow 35.0/120: 29% fury bloodlust, metamorphosis, death_sweep, momentum, potion_of_the_old_war
0:23.730 Waiting 1.300 sec 35.0/120: 29% fury bloodlust, metamorphosis, momentum
0:25.030 annihilation Fluffy_Pillow 99.0/120: 83% fury bloodlust, metamorphosis, momentum
0:25.863 eye_beam Fluffy_Pillow 59.0/120: 49% fury bloodlust, metamorphosis
0:27.243 auto_attack Fluffy_Pillow 9.0/120: 8% fury bloodlust, metamorphosis
0:27.243 Waiting 0.600 sec 9.0/120: 8% fury bloodlust, metamorphosis
0:27.843 death_sweep Fluffy_Pillow 59.0/120: 49% fury bloodlust, metamorphosis
0:28.674 throw_glaive Fluffy_Pillow 24.0/120: 20% fury bloodlust, raid_movement, metamorphosis, death_sweep
0:29.506 auto_attack Fluffy_Pillow 24.0/120: 20% fury bloodlust, metamorphosis
0:29.506 vengeful_retreat Fluffy_Pillow 24.0/120: 20% fury bloodlust, metamorphosis
0:29.506 Waiting 1.300 sec 24.0/120: 20% fury bloodlust, metamorphosis, momentum, vengeful_retreat_movement
0:30.806 fel_barrage Fluffy_Pillow 24.0/120: 20% fury bloodlust, momentum
0:32.190 auto_attack Fluffy_Pillow 24.0/120: 20% fury bloodlust, momentum
0:32.190 Waiting 0.600 sec 24.0/120: 20% fury bloodlust, momentum
0:32.790 blade_dance Fluffy_Pillow 40.0/120: 33% fury bloodlust, momentum
0:33.827 fel_rush Fluffy_Pillow 5.0/120: 4% fury bloodlust
0:34.252 throw_glaive Fluffy_Pillow 30.0/120: 25% fury bloodlust, momentum
0:35.290 Waiting 1.000 sec 30.0/120: 25% fury bloodlust, momentum
0:36.290 chaos_strike Fluffy_Pillow 82.0/120: 68% fury bloodlust, momentum
0:37.329 Waiting 0.800 sec 62.0/120: 52% fury bloodlust, momentum
0:38.129 chaos_strike Fluffy_Pillow 79.0/120: 66% fury bloodlust
0:39.168 throw_glaive Fluffy_Pillow 39.0/120: 33% fury bloodlust
0:40.207 Waiting 1.900 sec 39.0/120: 33% fury bloodlust
0:42.107 chaos_strike Fluffy_Pillow 89.0/120: 74% fury blood_frenzy
0:43.361 chaos_strike Fluffy_Pillow 69.0/120: 57% fury blood_frenzy
0:44.615 Waiting 0.400 sec 29.0/120: 24% fury raid_movement, blood_frenzy
0:45.015 auto_attack Fluffy_Pillow 29.0/120: 24% fury blood_frenzy
0:45.015 Waiting 2.200 sec 29.0/120: 24% fury blood_frenzy
0:47.215 chaos_strike Fluffy_Pillow 48.0/120: 40% fury blood_frenzy
0:48.469 Waiting 0.900 sec 8.0/120: 7% fury blood_frenzy
0:49.369 chaos_strike Fluffy_Pillow 43.0/120: 36% fury blood_frenzy
0:50.623 fel_rush Fluffy_Pillow 23.0/120: 19% fury raid_movement, blood_frenzy
0:51.062 throw_glaive Fluffy_Pillow 48.0/120: 40% fury raid_movement, momentum, blood_frenzy
0:52.314 Waiting 0.600 sec 48.0/120: 40% fury raid_movement, momentum
0:52.914 auto_attack Fluffy_Pillow 48.0/120: 40% fury momentum
0:52.914 blade_dance Fluffy_Pillow 48.0/120: 40% fury momentum
0:54.261 Waiting 0.400 sec 13.0/120: 11% fury momentum
0:54.661 vengeful_retreat Fluffy_Pillow 13.0/120: 11% fury
0:54.661 Waiting 0.500 sec 13.0/120: 11% fury momentum, vengeful_retreat_movement
0:55.161 throw_glaive Fluffy_Pillow 13.0/120: 11% fury momentum, vengeful_retreat_movement
0:56.747 Waiting 3.300 sec 13.0/120: 11% fury momentum
1:00.047 fel_rush Fluffy_Pillow 27.0/120: 23% fury raid_movement
1:00.457 Waiting 0.500 sec 52.0/120: 43% fury raid_movement, momentum
1:00.957 auto_attack Fluffy_Pillow 52.0/120: 43% fury momentum
1:00.957 Waiting 0.700 sec 52.0/120: 43% fury momentum
1:01.657 blade_dance Fluffy_Pillow 52.0/120: 43% fury momentum
1:03.225 fury_of_the_illidari Fluffy_Pillow 17.0/120: 14% fury momentum, blood_frenzy
1:04.479 fel_rush Fluffy_Pillow 17.0/120: 14% fury blood_frenzy
1:04.868 throw_glaive Fluffy_Pillow 42.0/120: 35% fury momentum, blood_frenzy
1:06.120 Waiting 1.400 sec 42.0/120: 35% fury momentum, blood_frenzy
1:07.520 chaos_strike Fluffy_Pillow 82.0/120: 68% fury momentum, blood_frenzy
1:08.772 Waiting 1.200 sec 42.0/120: 35% fury blood_frenzy
1:09.972 blade_dance Fluffy_Pillow 71.0/120: 59% fury blood_frenzy
1:11.461 Waiting 0.400 sec 36.0/120: 30% fury blood_frenzy
1:11.861 chaos_strike Fluffy_Pillow 64.0/120: 53% fury blood_frenzy
1:13.116 Waiting 2.900 sec 24.0/120: 20% fury
1:16.016 throw_glaive Fluffy_Pillow 24.0/120: 20% fury raid_movement
1:17.364 auto_attack Fluffy_Pillow 24.0/120: 20% fury
1:17.364 Waiting 2.100 sec 24.0/120: 20% fury
1:19.464 vengeful_retreat Fluffy_Pillow 24.0/120: 20% fury
1:19.661 Waiting 1.300 sec 24.0/120: 20% fury momentum, vengeful_retreat_movement
1:20.961 fel_rush Fluffy_Pillow 24.0/120: 20% fury raid_movement, momentum
1:21.331 throw_glaive Fluffy_Pillow 49.0/120: 41% fury momentum, out_of_range
1:22.878 auto_attack Fluffy_Pillow 49.0/120: 41% fury momentum, blood_frenzy
1:22.878 blade_dance Fluffy_Pillow 49.0/120: 41% fury momentum, blood_frenzy
1:24.131 fel_barrage Fluffy_Pillow 14.0/120: 12% fury momentum, blood_frenzy
1:25.705 auto_attack Fluffy_Pillow 14.0/120: 12% fury blood_frenzy
1:25.705 Waiting 2.700 sec 14.0/120: 12% fury blood_frenzy
1:28.405 eye_beam Fluffy_Pillow 66.0/120: 55% fury blood_frenzy
1:30.218 Waiting 0.200 sec 16.0/120: 13% fury metamorphosis, blood_frenzy
1:30.418 throw_glaive Fluffy_Pillow 16.0/120: 13% fury blood_frenzy
1:31.672 fel_rush Fluffy_Pillow 16.0/120: 13% fury blood_frenzy
1:32.113 Waiting 0.900 sec 41.0/120: 34% fury raid_movement, momentum, blood_frenzy
1:33.013 auto_attack Fluffy_Pillow 41.0/120: 34% fury momentum, blood_frenzy
1:33.013 blade_dance Fluffy_Pillow 41.0/120: 34% fury momentum, blood_frenzy
1:34.264 Waiting 1.500 sec 6.0/120: 5% fury momentum, blood_frenzy
1:35.764 fel_rush Fluffy_Pillow 35.0/120: 29% fury blood_frenzy
1:36.193 Waiting 1.200 sec 60.0/120: 50% fury momentum, blood_frenzy
1:37.393 chaos_strike Fluffy_Pillow 96.0/120: 80% fury momentum, blood_frenzy
1:38.647 throw_glaive Fluffy_Pillow 76.0/120: 63% fury momentum, blood_frenzy
1:39.900 chaos_strike Fluffy_Pillow 76.0/120: 63% fury blood_frenzy
1:41.153 chaos_strike Fluffy_Pillow 56.0/120: 47% fury blood_frenzy
1:42.406 Waiting 1.500 sec 16.0/120: 13% fury blood_frenzy
1:43.906 chaos_strike Fluffy_Pillow 77.0/120: 64% fury blood_frenzy
1:45.160 vengeful_retreat Fluffy_Pillow 37.0/120: 31% fury blood_frenzy
1:45.160 Waiting 1.200 sec 37.0/120: 31% fury momentum, vengeful_retreat_movement, blood_frenzy
1:46.360 throw_glaive Fluffy_Pillow 70.0/120: 58% fury momentum, out_of_range, blood_frenzy
1:47.778 chaos_strike Fluffy_Pillow 70.0/120: 58% fury momentum, blood_frenzy
1:49.030 auto_attack Fluffy_Pillow 30.0/120: 25% fury momentum, blood_frenzy
1:49.030 Waiting 1.000 sec 30.0/120: 25% fury momentum, blood_frenzy
1:50.030 fel_rush Fluffy_Pillow 30.0/120: 25% fury raid_movement
1:50.423 Waiting 2.500 sec 55.0/120: 46% fury raid_movement, momentum
1:52.923 auto_attack Fluffy_Pillow 55.0/120: 46% fury momentum
1:52.923 blade_dance Fluffy_Pillow 55.0/120: 46% fury momentum
1:54.272 Waiting 0.600 sec 20.0/120: 17% fury blood_frenzy
1:54.872 throw_glaive Fluffy_Pillow 20.0/120: 17% fury blood_frenzy
1:56.348 Waiting 4.700 sec 37.0/120: 31% fury blood_frenzy
2:01.048 blade_dance Fluffy_Pillow 74.0/120: 62% fury blood_frenzy
2:02.507 fel_rush Fluffy_Pillow 39.0/120: 33% fury blood_frenzy
2:02.942 fel_barrage Fluffy_Pillow 64.0/120: 53% fury momentum
2:04.481 throw_glaive Fluffy_Pillow 64.0/120: 53% fury raid_movement, momentum
2:05.829 auto_attack Fluffy_Pillow 64.0/120: 53% fury momentum
2:05.829 fury_of_the_illidari Fluffy_Pillow 64.0/120: 53% fury momentum
2:07.178 Waiting 1.500 sec 64.0/120: 53% fury
2:08.678 chaos_strike Fluffy_Pillow 117.0/120: 98% fury
2:10.027 vengeful_retreat Fluffy_Pillow 97.0/120: 81% fury
2:10.160 chaos_strike Fluffy_Pillow 97.0/120: 81% fury momentum, vengeful_retreat_movement
2:11.509 chaos_strike Fluffy_Pillow 77.0/120: 64% fury momentum
2:12.859 Waiting 0.500 sec 37.0/120: 31% fury momentum
2:13.359 chaos_strike Fluffy_Pillow 88.0/120: 73% fury momentum
2:14.708 fel_rush Fluffy_Pillow 68.0/120: 57% fury
2:15.104 chaos_strike Fluffy_Pillow 93.0/120: 78% fury momentum
2:16.452 chaos_strike Fluffy_Pillow 73.0/120: 61% fury momentum
2:17.799 Waiting 0.200 sec 33.0/120: 28% fury momentum
2:17.999 chaos_strike Fluffy_Pillow 63.0/120: 53% fury momentum
2:19.347 chaos_strike Fluffy_Pillow 43.0/120: 36% fury
2:20.694 auto_attack Fluffy_Pillow 23.0/120: 19% fury
2:20.694 fel_rush Fluffy_Pillow 23.0/120: 19% fury
2:21.143 blade_dance Fluffy_Pillow 48.0/120: 40% fury momentum
2:22.493 throw_glaive Fluffy_Pillow 13.0/120: 11% fury momentum
2:23.842 throw_glaive Fluffy_Pillow 13.0/120: 11% fury momentum
2:25.191 fel_rush Fluffy_Pillow 13.0/120: 11% fury
2:25.630 Waiting 2.100 sec 38.0/120: 32% fury momentum
2:27.730 eye_beam Fluffy_Pillow 111.0/120: 93% fury momentum
2:29.781 Waiting 0.100 sec 61.0/120: 51% fury
2:29.881 blade_dance Fluffy_Pillow 61.0/120: 51% fury
2:31.454 throw_glaive Fluffy_Pillow 61.0/120: 51% fury
2:32.803 Waiting 1.900 sec 61.0/120: 51% fury
2:34.703 chaos_strike Fluffy_Pillow 110.0/120: 92% fury
2:36.052 vengeful_retreat Fluffy_Pillow 70.0/120: 58% fury raid_movement
2:36.052 auto_attack Fluffy_Pillow 70.0/120: 58% fury momentum, vengeful_retreat_movement
2:36.052 fel_barrage Fluffy_Pillow 70.0/120: 58% fury momentum, vengeful_retreat_movement
2:37.703 Waiting 0.700 sec 70.0/120: 58% fury momentum
2:38.403 chaos_strike Fluffy_Pillow 88.0/120: 73% fury momentum
2:39.752 blade_dance Fluffy_Pillow 48.0/120: 40% fury momentum
2:41.100 Waiting 2.000 sec 13.0/120: 11% fury
2:43.100 chaos_strike Fluffy_Pillow 46.0/120: 38% fury blood_frenzy
2:44.353 Waiting 0.400 sec 6.0/120: 5% fury blood_frenzy
2:44.753 fel_rush Fluffy_Pillow 6.0/120: 5% fury blood_frenzy
2:45.183 Waiting 2.200 sec 31.0/120: 26% fury momentum, blood_frenzy
2:47.383 chaos_strike Fluffy_Pillow 64.0/120: 53% fury momentum, blood_frenzy
2:48.636 Waiting 1.000 sec 24.0/120: 20% fury momentum, blood_frenzy
2:49.636 chaos_strike Fluffy_Pillow 40.0/120: 33% fury blood_frenzy
2:50.890 throw_glaive Fluffy_Pillow 0.0/120: 0% fury raid_movement, blood_frenzy
2:52.143 fel_rush Fluffy_Pillow 0.0/120: 0% fury raid_movement, blood_frenzy
2:52.542 auto_attack Fluffy_Pillow 25.0/120: 21% fury momentum, blood_frenzy
2:52.542 throw_glaive Fluffy_Pillow 25.0/120: 21% fury momentum, blood_frenzy
2:53.795 Waiting 2.400 sec 25.0/120: 21% fury momentum
2:56.195 fel_rush Fluffy_Pillow 25.0/120: 21% fury
2:56.644 blade_dance Fluffy_Pillow 50.0/120: 42% fury momentum, blood_frenzy
2:57.897 Waiting 1.300 sec 15.0/120: 13% fury momentum, blood_frenzy
2:59.197 throw_glaive Fluffy_Pillow 15.0/120: 13% fury momentum, blood_frenzy
3:00.698 Waiting 0.200 sec 55.0/120: 46% fury blood_frenzy
3:00.898 vengeful_retreat Fluffy_Pillow 55.0/120: 46% fury blood_frenzy
3:01.052 Waiting 3.700 sec 55.0/120: 46% fury momentum, vengeful_retreat_movement, blood_frenzy
3:04.752 blade_dance Fluffy_Pillow 68.0/120: 57% fury momentum, blood_frenzy
3:06.231 fury_of_the_illidari Fluffy_Pillow 33.0/120: 28% fury blood_frenzy
3:07.484 Waiting 0.100 sec 33.0/120: 28% fury blood_frenzy
3:07.584 throw_glaive Fluffy_Pillow 33.0/120: 28% fury blood_frenzy
3:09.030 auto_attack Fluffy_Pillow 33.0/120: 28% fury blood_frenzy
3:09.030 fel_rush Fluffy_Pillow 33.0/120: 28% fury blood_frenzy
3:09.429 Waiting 0.600 sec 58.0/120: 48% fury momentum, blood_frenzy
3:10.029 chaos_strike Fluffy_Pillow 58.0/120: 48% fury momentum, blood_frenzy
3:11.282 Waiting 2.100 sec 38.0/120: 32% fury momentum, blood_frenzy
3:13.382 chaos_strike Fluffy_Pillow 56.0/120: 47% fury blood_frenzy
3:14.635 Waiting 0.900 sec 36.0/120: 30% fury blood_frenzy
3:15.535 chaos_strike Fluffy_Pillow 66.0/120: 55% fury blood_frenzy
3:16.789 chaos_strike Fluffy_Pillow 46.0/120: 38% fury blood_frenzy
3:18.044 Waiting 1.900 sec 6.0/120: 5% fury blood_frenzy
3:19.944 chaos_strike Fluffy_Pillow 43.0/120: 36% fury blood_frenzy
3:21.198 throw_glaive Fluffy_Pillow 3.0/120: 3% fury raid_movement
3:22.548 Waiting 0.400 sec 3.0/120: 3% fury raid_movement
3:22.948 auto_attack Fluffy_Pillow 3.0/120: 3% fury
3:22.948 Waiting 1.300 sec 3.0/120: 3% fury
3:24.248 throw_glaive Fluffy_Pillow 3.0/120: 3% fury raid_movement
3:25.789 auto_attack Fluffy_Pillow 3.0/120: 3% fury
3:25.789 fel_rush Fluffy_Pillow 3.0/120: 3% fury
3:26.153 fel_barrage Fluffy_Pillow 28.0/120: 23% fury momentum
3:27.687 Waiting 2.200 sec 28.0/120: 23% fury momentum
3:29.887 vengeful_retreat Fluffy_Pillow 28.0/120: 23% fury
3:29.887 Waiting 2.900 sec 28.0/120: 23% fury momentum, vengeful_retreat_movement
3:32.787 blade_dance Fluffy_Pillow 46.0/120: 38% fury momentum
3:34.138 throw_glaive Fluffy_Pillow 11.0/120: 9% fury
3:35.487 Waiting 0.400 sec 11.0/120: 9% fury
3:35.887 fel_rush Fluffy_Pillow 11.0/120: 9% fury
3:36.302 Waiting 1.200 sec 36.0/120: 30% fury momentum
3:37.502 eye_beam Fluffy_Pillow 89.0/120: 74% fury momentum
3:39.533 Waiting 1.400 sec 39.0/120: 33% fury momentum
3:40.933 auto_attack Fluffy_Pillow 39.0/120: 33% fury
3:40.933 Waiting 2.400 sec 39.0/120: 33% fury
3:43.333 chaos_strike Fluffy_Pillow 67.0/120: 56% fury blood_frenzy
3:44.585 chaos_strike Fluffy_Pillow 47.0/120: 39% fury blood_frenzy
3:45.837 Waiting 0.100 sec 7.0/120: 6% fury blood_frenzy
3:45.937 fel_rush Fluffy_Pillow 7.0/120: 6% fury blood_frenzy
3:46.474 Waiting 1.200 sec 32.0/120: 27% fury momentum, blood_frenzy
3:47.674 chaos_strike Fluffy_Pillow 80.0/120: 67% fury momentum, blood_frenzy
3:48.929 chaos_strike Fluffy_Pillow 40.0/120: 33% fury momentum, blood_frenzy
3:50.184 throw_glaive Fluffy_Pillow 20.0/120: 17% fury raid_movement, blood_frenzy
3:51.438 throw_glaive Fluffy_Pillow 20.0/120: 17% fury raid_movement, blood_frenzy
3:52.693 Waiting 0.300 sec 20.0/120: 17% fury raid_movement, blood_frenzy
3:52.993 auto_attack Fluffy_Pillow 20.0/120: 17% fury blood_frenzy
3:52.993 Waiting 1.700 sec 20.0/120: 17% fury blood_frenzy
3:54.693 vengeful_retreat Fluffy_Pillow 20.0/120: 17% fury blood_frenzy
3:54.887 Waiting 2.100 sec 20.0/120: 17% fury momentum, vengeful_retreat_movement, blood_frenzy
3:56.987 auto_attack Fluffy_Pillow 20.0/120: 17% fury momentum, blood_frenzy
3:56.987 Waiting 1.900 sec 20.0/120: 17% fury momentum, blood_frenzy
3:58.887 fel_rush Fluffy_Pillow 20.0/120: 17% fury blood_frenzy
3:59.272 blade_dance Fluffy_Pillow 45.0/120: 38% fury momentum, blood_frenzy
4:00.527 throw_glaive Fluffy_Pillow 10.0/120: 8% fury momentum, blood_frenzy
4:01.779 Waiting 3.900 sec 10.0/120: 8% fury momentum, blood_frenzy
4:05.679 metamorphosis Fluffy_Pillow 101.0/120: 84% fury blood_frenzy
4:06.725 potion Fluffy_Pillow 101.0/120: 84% fury metamorphosis, blood_frenzy
4:06.725 fury_of_the_illidari Fluffy_Pillow 101.0/120: 84% fury metamorphosis, blood_frenzy, potion_of_the_old_war
4:07.729 death_sweep Fluffy_Pillow 101.0/120: 84% fury metamorphosis, blood_frenzy, potion_of_the_old_war
4:08.733 Waiting 0.200 sec 66.0/120: 55% fury metamorphosis, blood_frenzy, potion_of_the_old_war
4:08.933 fel_rush Fluffy_Pillow 66.0/120: 55% fury metamorphosis, blood_frenzy, potion_of_the_old_war
4:09.317 throw_glaive Fluffy_Pillow 91.0/120: 76% fury metamorphosis, momentum, potion_of_the_old_war
4:10.399 annihilation Fluffy_Pillow 91.0/120: 76% fury metamorphosis, momentum, potion_of_the_old_war
4:11.479 fel_barrage Fluffy_Pillow 51.0/120: 43% fury metamorphosis, momentum, potion_of_the_old_war
4:12.703 Waiting 0.300 sec 51.0/120: 43% fury raid_movement, metamorphosis, momentum, potion_of_the_old_war
4:13.003 auto_attack Fluffy_Pillow 51.0/120: 43% fury metamorphosis, potion_of_the_old_war
4:13.003 annihilation Fluffy_Pillow 51.0/120: 43% fury metamorphosis, potion_of_the_old_war
4:14.082 Waiting 0.800 sec 11.0/120: 9% fury metamorphosis, potion_of_the_old_war
4:14.882 annihilation Fluffy_Pillow 74.0/120: 62% fury metamorphosis, potion_of_the_old_war
4:15.961 annihilation Fluffy_Pillow 54.0/120: 45% fury metamorphosis, potion_of_the_old_war
4:17.039 Waiting 1.600 sec 14.0/120: 12% fury metamorphosis, potion_of_the_old_war
4:18.639 annihilation Fluffy_Pillow 80.0/120: 67% fury metamorphosis, potion_of_the_old_war
4:19.719 vengeful_retreat Fluffy_Pillow 60.0/120: 50% fury metamorphosis, potion_of_the_old_war
4:19.887 annihilation Fluffy_Pillow 60.0/120: 50% fury metamorphosis, momentum, vengeful_retreat_movement, potion_of_the_old_war
4:20.966 throw_glaive Fluffy_Pillow 20.0/120: 17% fury raid_movement, metamorphosis, momentum, out_of_range, potion_of_the_old_war
4:22.045 Waiting 0.900 sec 20.0/120: 17% fury raid_movement, metamorphosis, momentum, potion_of_the_old_war
4:22.945 auto_attack Fluffy_Pillow 20.0/120: 17% fury metamorphosis, momentum, potion_of_the_old_war
4:22.945 Waiting 0.300 sec 20.0/120: 17% fury metamorphosis, momentum, potion_of_the_old_war
4:23.245 throw_glaive Fluffy_Pillow 20.0/120: 17% fury metamorphosis, momentum, potion_of_the_old_war
4:24.571 fel_rush Fluffy_Pillow 20.0/120: 17% fury metamorphosis, potion_of_the_old_war
4:24.996 death_sweep Fluffy_Pillow 45.0/120: 38% fury metamorphosis, momentum, potion_of_the_old_war
4:26.076 Waiting 2.500 sec 10.0/120: 8% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
4:28.576 fel_rush Fluffy_Pillow 42.0/120: 35% fury raid_movement, metamorphosis, blood_frenzy, potion_of_the_old_war
4:29.008 auto_attack Fluffy_Pillow 67.0/120: 56% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
4:29.008 eye_beam Fluffy_Pillow 67.0/120: 56% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
4:30.599 throw_glaive Fluffy_Pillow 17.0/120: 14% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
4:31.603 Waiting 0.900 sec 17.0/120: 14% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
4:32.503 death_sweep Fluffy_Pillow 42.0/120: 35% fury metamorphosis, momentum, blood_frenzy
4:33.508 Waiting 3.300 sec 7.0/120: 6% fury metamorphosis, blood_frenzy
4:36.808 throw_glaive Fluffy_Pillow 72.0/120: 60% fury blood_frenzy
4:38.214 blade_dance Fluffy_Pillow 72.0/120: 60% fury blood_frenzy
4:39.467 Waiting 1.400 sec 37.0/120: 31% fury
4:40.867 chaos_strike Fluffy_Pillow 84.0/120: 70% fury
4:42.215 chaos_strike Fluffy_Pillow 64.0/120: 53% fury
4:43.562 chaos_strike Fluffy_Pillow 44.0/120: 37% fury
4:44.913 vengeful_retreat Fluffy_Pillow 4.0/120: 3% fury raid_movement
4:44.913 auto_attack Fluffy_Pillow 4.0/120: 3% fury momentum, vengeful_retreat_movement
4:44.913 Waiting 0.900 sec 4.0/120: 3% fury momentum, vengeful_retreat_movement
4:45.813 throw_glaive Fluffy_Pillow 4.0/120: 3% fury momentum, out_of_range, vengeful_retreat_movement
4:47.161 Waiting 0.100 sec 4.0/120: 3% fury momentum
4:47.261 chaos_strike Fluffy_Pillow 52.0/120: 43% fury momentum
4:48.611 Waiting 0.400 sec 32.0/120: 27% fury momentum
4:49.011 fel_rush Fluffy_Pillow 32.0/120: 27% fury
4:49.372 chaos_strike Fluffy_Pillow 57.0/120: 48% fury momentum, blood_frenzy
4:50.626 fel_rush Fluffy_Pillow 37.0/120: 31% fury raid_movement, momentum, blood_frenzy
4:51.026 Waiting 0.500 sec 62.0/120: 52% fury momentum, out_of_range, blood_frenzy
4:51.526 auto_attack Fluffy_Pillow 62.0/120: 52% fury momentum, blood_frenzy
4:51.526 blade_dance Fluffy_Pillow 62.0/120: 52% fury momentum, blood_frenzy
4:52.780 throw_glaive Fluffy_Pillow 27.0/120: 23% fury momentum, blood_frenzy
4:54.034 Waiting 4.000 sec 27.0/120: 23% fury momentum, blood_frenzy
4:58.034 chaos_strike Fluffy_Pillow 83.0/120: 69% fury blood_frenzy
4:59.287 Waiting 0.400 sec 63.0/120: 53% fury blood_frenzy
4:59.687 blade_dance Fluffy_Pillow 63.0/120: 53% fury blood_frenzy
5:01.111 auto_attack Fluffy_Pillow 28.0/120: 23% fury
5:01.111 throw_glaive Fluffy_Pillow 28.0/120: 23% fury
5:02.458 Waiting 3.400 sec 28.0/120: 23% fury
5:05.858 chaos_strike Fluffy_Pillow 95.0/120: 79% fury
5:07.205 fury_of_the_illidari Fluffy_Pillow 75.0/120: 63% fury
5:08.553 blade_dance Fluffy_Pillow 75.0/120: 63% fury
5:10.111 vengeful_retreat Fluffy_Pillow 40.0/120: 33% fury
5:10.111 throw_glaive Fluffy_Pillow 40.0/120: 33% fury momentum, vengeful_retreat_movement
5:11.457 chaos_strike Fluffy_Pillow 40.0/120: 33% fury momentum
5:12.805 fel_barrage Fluffy_Pillow 0.0/120: 0% fury momentum
5:14.309 fel_rush Fluffy_Pillow 0.0/120: 0% fury
5:14.713 Waiting 0.400 sec 25.0/120: 21% fury momentum
5:15.113 eye_beam Fluffy_Pillow 58.0/120: 48% fury momentum
5:16.636 Waiting 0.300 sec 8.0/120: 7% fury raid_movement, metamorphosis, momentum
5:16.936 auto_attack Fluffy_Pillow 8.0/120: 7% fury metamorphosis, momentum
5:16.936 Waiting 1.400 sec 8.0/120: 7% fury metamorphosis, momentum
5:18.336 fel_rush Fluffy_Pillow 8.0/120: 7% fury
5:18.707 Waiting 0.100 sec 33.0/120: 28% fury momentum
5:18.807 throw_glaive Fluffy_Pillow 33.0/120: 28% fury momentum
5:20.321 Waiting 1.300 sec 33.0/120: 28% fury momentum
5:21.621 chaos_strike Fluffy_Pillow 59.0/120: 49% fury momentum
5:22.969 Waiting 1.000 sec 39.0/120: 33% fury
5:23.969 chaos_strike Fluffy_Pillow 73.0/120: 61% fury
5:25.317 chaos_strike Fluffy_Pillow 53.0/120: 44% fury
5:26.665 Waiting 2.000 sec 33.0/120: 28% fury
5:28.665 chaos_strike Fluffy_Pillow 87.0/120: 73% fury
5:30.013 chaos_strike Fluffy_Pillow 67.0/120: 56% fury
5:31.362 Waiting 0.700 sec 27.0/120: 23% fury
5:32.062 throw_glaive Fluffy_Pillow 27.0/120: 23% fury raid_movement
5:33.410 auto_attack Fluffy_Pillow 27.0/120: 23% fury
5:33.410 Waiting 0.900 sec 27.0/120: 23% fury
5:34.310 fel_rush Fluffy_Pillow 27.0/120: 23% fury
5:34.749 chaos_strike Fluffy_Pillow 52.0/120: 43% fury momentum
5:36.099 Waiting 0.600 sec 32.0/120: 27% fury momentum
5:36.699 throw_glaive Fluffy_Pillow 32.0/120: 27% fury momentum
5:38.245 Waiting 0.100 sec 32.0/120: 27% fury momentum
5:38.345 vengeful_retreat Fluffy_Pillow 32.0/120: 27% fury
5:38.345 Waiting 2.100 sec 32.0/120: 27% fury momentum, vengeful_retreat_movement
5:40.445 chaos_strike Fluffy_Pillow 99.0/120: 83% fury momentum
5:41.794 chaos_strike Fluffy_Pillow 59.0/120: 49% fury momentum
5:43.142 Waiting 1.200 sec 19.0/120: 16% fury
5:44.342 fel_rush Fluffy_Pillow 19.0/120: 16% fury
5:44.798 chaos_strike Fluffy_Pillow 44.0/120: 37% fury momentum
5:46.146 throw_glaive Fluffy_Pillow 4.0/120: 3% fury momentum
5:47.496 Waiting 0.900 sec 4.0/120: 3% fury momentum
5:48.396 fel_rush Fluffy_Pillow 4.0/120: 3% fury raid_movement
5:48.768 Waiting 0.200 sec 29.0/120: 24% fury raid_movement, momentum
5:48.968 auto_attack Fluffy_Pillow 29.0/120: 24% fury momentum
5:48.968 Waiting 2.400 sec 29.0/120: 24% fury momentum
5:51.368 chaos_strike Fluffy_Pillow 93.0/120: 78% fury momentum, blood_frenzy
5:52.620 chaos_strike Fluffy_Pillow 73.0/120: 61% fury blood_frenzy
5:53.874 Waiting 1.800 sec 33.0/120: 28% fury blood_frenzy
5:55.674 chaos_strike Fluffy_Pillow 96.0/120: 80% fury blood_frenzy
5:56.927 chaos_strike Fluffy_Pillow 76.0/120: 63% fury blood_frenzy
5:58.180 Waiting 1.800 sec 36.0/120: 30% fury blood_frenzy
5:59.980 eye_beam Fluffy_Pillow 109.0/120: 91% fury blood_frenzy
6:02.002 annihilation Fluffy_Pillow 59.0/120: 49% fury metamorphosis, blood_frenzy
6:03.256 vengeful_retreat Fluffy_Pillow 19.0/120: 16% fury blood_frenzy
6:03.345 throw_glaive Fluffy_Pillow 19.0/120: 16% fury momentum, vengeful_retreat_movement, blood_frenzy
6:04.601 throw_glaive Fluffy_Pillow 19.0/120: 16% fury raid_movement, momentum, blood_frenzy
6:05.854 auto_attack Fluffy_Pillow 19.0/120: 16% fury momentum, blood_frenzy
6:05.854 Waiting 1.200 sec 19.0/120: 16% fury momentum, blood_frenzy
6:07.054 fury_of_the_illidari Fluffy_Pillow 19.0/120: 16% fury momentum, blood_frenzy
6:08.458 fel_rush Fluffy_Pillow 19.0/120: 16% fury blood_frenzy
6:08.855 chaos_strike Fluffy_Pillow 44.0/120: 37% fury momentum, blood_frenzy
6:10.108 Waiting 0.100 sec 4.0/120: 3% fury momentum, blood_frenzy
6:10.208 chaos_strike Fluffy_Pillow 40.0/120: 33% fury momentum, blood_frenzy
6:11.462 throw_glaive Fluffy_Pillow 0.0/120: 0% fury momentum, blood_frenzy
6:12.931 Waiting 1.600 sec 0.0/120: 0% fury blood_frenzy
6:14.531 chaos_strike Fluffy_Pillow 46.0/120: 38% fury blood_frenzy
6:15.785 Waiting 1.100 sec 6.0/120: 5% fury
6:16.885 chaos_strike Fluffy_Pillow 41.0/120: 34% fury blood_frenzy
6:18.139 Waiting 0.400 sec 1.0/120: 1% fury blood_frenzy
6:18.539 fel_rush Fluffy_Pillow 1.0/120: 1% fury blood_frenzy
6:19.001 fel_barrage Fluffy_Pillow 26.0/120: 22% fury momentum, blood_frenzy
6:20.501 throw_glaive Fluffy_Pillow 26.0/120: 22% fury raid_movement, momentum, blood_frenzy
6:21.754 auto_attack Fluffy_Pillow 26.0/120: 22% fury momentum, blood_frenzy
6:21.754 Waiting 0.600 sec 26.0/120: 22% fury momentum, blood_frenzy
6:22.354 chaos_strike Fluffy_Pillow 44.0/120: 37% fury momentum, blood_frenzy
6:23.606 fel_rush Fluffy_Pillow 4.0/120: 3% fury blood_frenzy
6:23.960 Waiting 0.500 sec 29.0/120: 24% fury momentum, blood_frenzy
6:24.460 chaos_strike Fluffy_Pillow 60.0/120: 50% fury momentum, blood_frenzy
6:25.713 Waiting 0.900 sec 20.0/120: 17% fury momentum, blood_frenzy
6:26.613 chaos_strike Fluffy_Pillow 50.0/120: 42% fury momentum, blood_frenzy
6:27.868 Waiting 0.300 sec 30.0/120: 25% fury blood_frenzy
6:28.168 vengeful_retreat Fluffy_Pillow 30.0/120: 25% fury blood_frenzy
6:28.345 throw_glaive Fluffy_Pillow 30.0/120: 25% fury momentum, vengeful_retreat_movement, blood_frenzy
6:29.752 Waiting 1.200 sec 30.0/120: 25% fury momentum, blood_frenzy
6:30.952 chaos_strike Fluffy_Pillow 77.0/120: 64% fury momentum, blood_frenzy
6:32.208 Waiting 1.000 sec 37.0/120: 31% fury momentum, blood_frenzy
6:33.208 chaos_strike Fluffy_Pillow 67.0/120: 56% fury
6:34.555 Waiting 1.500 sec 27.0/120: 23% fury blood_frenzy
6:36.055 fel_rush Fluffy_Pillow 27.0/120: 23% fury raid_movement, blood_frenzy

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8803 8478 0
Agility 25250 23544 13392 (8360)
Stamina 32232 32232 19893
Intellect 5328 5003 0
Spirit 2 2 0
Health 1933920 1933920 0
Fury 120 120 0
Crit 37.68% 36.61% 7213
Haste 11.57% 11.57% 3761
Damage / Heal Versatility 2.30% 2.30% 921
Attack Power 25250 23544 0
Mastery 23.18% 23.18% 5313
Armor 2045 2045 2045
Run Speed 9 0 0
Leech 1.37% 1.37% 314

Gear

Source Slot Average Item Level: 856.00
Local Head Vindictive Gladiator's Felskin Helm of the Quickblade
ilevel: 845, stats: { 263 Armor, +1238 Agi, +1857 Sta, +915 Crit, +366 Vers }
Local Neck Cursed Beartooth Necklace
ilevel: 850, stats: { +1094 Sta, +997 Mastery, +839 Haste }
Local Shoulders Mana-Saber Hide Shoulders
ilevel: 835, stats: { 235 Armor, +846 AgiInt, +1269 Sta, +621 Mastery, +304 Crit, +397 Avoidance }
Local Chest Scarred Ragefang Chestpiece
ilevel: 850, stats: { 329 Armor, +1945 Sta, +1297 AgiInt, +820 Mastery, +484 Haste }
Local Waist Forest-Lord's Waistwrap
ilevel: 865, stats: { 195 Armor, +1678 Sta, +1119 AgiInt, +673 Haste, +362 Mastery }
Local Legs Splotched Bloodfur Leggings
ilevel: 865, stats: { 303 Armor, +2237 Sta, +1491 AgiInt, +986 Crit, +394 Mastery }
Local Feet Grove Darkener's Treads
ilevel: 850, stats: { 226 Armor, +973 AgiInt, +1459 Sta, +658 Mastery, +322 Vers }
Local Wrists Wristwraps of Broken Trust
ilevel: 855, stats: { 146 Armor, +1147 Sta, +765 AgiInt, +454 Mastery, +294 Crit }
Local Hands Cruel Vice Grips
ilevel: 860, stats: { 213 Armor, +1601 Sta, +1068 AgiInt, +595 Crit, +421 Mastery }
Local Finger1 Ring of Frozen Magic
ilevel: 870, stats: { +1319 Sta, +1188 Haste, +791 Crit }
Local Finger2 Twice-Warped Azsharan Signet
ilevel: 850, stats: { +1094 Sta, +1258 Crit, +577 Haste, +314 Leech }
Local Trinket1 Three-Toed Rabbit Foot
ilevel: 850, stats: { +1233 Agi, +932 Crit }
Local Trinket2 Bloodthirsty Instinct
ilevel: 850, stats: { +1233 Agi }
Local Back Drape of the Mana-Starved
ilevel: 860, stats: { 135 Armor, +1201 Sta, +801 StrAgiInt, +528 Crit, +233 Vers }
Local Main Hand Twinblades of the Deceiver
ilevel: 869, weapon: { 3933 - 7306, 2.6 }, stats: { +664 Agi, +996 Sta, +305 Crit, +293 Mastery }, relics: { +39 ilevels, +40 ilevels, +40 ilevels }
Local Off Hand Twinblades of the Deceiver
ilevel: 869, weapon: { 3933 - 7306, 2.6 }, stats: { +664 Agi, +996 Sta, +305 Crit, +293 Mastery }

Talents

Level
15 Fel Mastery (Havoc Demon Hunter) Chaos Cleave (Havoc Demon Hunter) Blind Fury (Havoc Demon Hunter)
30 Prepared (Havoc Demon Hunter) Demon Blades (Havoc Demon Hunter) Demonic Appetite (Havoc Demon Hunter)
45 Felblade First Blood (Havoc Demon Hunter) Bloodlet (Havoc Demon Hunter)
60 Netherwalk (Havoc Demon Hunter) Desperate Instincts (Havoc Demon Hunter) Soul Rending (Havoc Demon Hunter)
75 Momentum (Havoc Demon Hunter) Fel Eruption (Havoc Demon Hunter) Nemesis (Havoc Demon Hunter)
90 Master of the Glaive (Havoc Demon Hunter) Unleashed Power (Havoc Demon Hunter) Demon Reborn (Havoc Demon Hunter)
100 Chaos Blades (Havoc Demon Hunter) Fel Barrage (Havoc Demon Hunter) Demonic (Havoc Demon Hunter)

Profile

demonhunter="Táunks"
origin="https://us.api.battle.net/wow/character/thrall/Táunks/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/107/157266795-avatar.jpg"
level=110
race=blood_elf
role=attack
position=back
professions=skinning=800
talents=1233112
talent_override=fel_barrage,if=active_enemies>1|raid_event.adds.exists
artifact=3:0:0:0:0:1000:2:1001:3:1002:3:1003:3:1004:3:1006:3:1007:3:1010:1:1011:1:1013:1:1014:1:1016:1:1330:1
spec=havoc

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war
actions.precombat+=/metamorphosis

# Executed every time the actor is available.
actions=auto_attack
# "Getting ready to use meta" conditions, this is used in a few places.
actions+=/variable,name=pooling_for_meta,value=cooldown.metamorphosis.ready&buff.metamorphosis.down&(!talent.demonic.enabled|!cooldown.eye_beam.ready)&(!talent.chaos_blades.enabled|cooldown.chaos_blades.ready)&(!talent.nemesis.enabled|debuff.nemesis.up|cooldown.nemesis.ready)
# Blade Dance conditions. Always if First Blood is talented, otherwise 3+ targets with Chaos Cleave or 2+ targets without.
actions+=/variable,name=blade_dance,value=talent.first_blood.enabled|spell_targets.blade_dance1>=2+talent.chaos_cleave.enabled
# Blade Dance pooling condition, so we don't spend too much fury when we need it soon. No need to pool on
# single target since First Blood already makes it cheap enough and delaying it a tiny bit isn't a big deal.
actions+=/variable,name=pooling_for_blade_dance,value=variable.blade_dance&fury-40<35-talent.first_blood.enabled*20&spell_targets.blade_dance1>=2
actions+=/blur,if=artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
actions+=/call_action_list,name=cooldown
# Fel Rush in at the start of combat.
actions+=/fel_rush,animation_cancel=1,if=time=0
actions+=/pick_up_fragment,if=talent.demonic_appetite.enabled&fury.deficit>=30
actions+=/consume_magic
# Vengeful Retreat backwards through the target to minimize downtime.
actions+=/vengeful_retreat,if=(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
# Fel Rush for Momentum and for fury from Fel Mastery.
actions+=/fel_rush,animation_cancel=1,if=(talent.momentum.enabled|talent.fel_mastery.enabled)&(!talent.momentum.enabled|(charges=2|cooldown.vengeful_retreat.remains>4)&buff.momentum.down)&(!talent.fel_mastery.enabled|fury.deficit>=25)&(charges=2|(raid_event.movement.in>10&raid_event.adds.in>10))
# Use Fel Barrage at max charges, saving it for Momentum and adds if possible.
actions+=/fel_barrage,if=charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
actions+=/throw_glaive,if=talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
actions+=/fury_of_the_illidari,if=active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
actions+=/eye_beam,if=talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
actions+=/death_sweep,if=variable.blade_dance
actions+=/blade_dance,if=variable.blade_dance
actions+=/throw_glaive,if=talent.bloodlet.enabled&spell_targets>=2+talent.chaos_cleave.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&(spell_targets>=3|raid_event.adds.in>recharge_time+cooldown)
actions+=/fel_eruption
actions+=/felblade,if=fury.deficit>=30+buff.prepared.up*8
actions+=/annihilation,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
actions+=/throw_glaive,if=talent.bloodlet.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&raid_event.adds.in>recharge_time+cooldown
actions+=/eye_beam,if=!talent.demonic.enabled&((spell_targets.eye_beam_tick>desired_targets&active_enemies>1)|(raid_event.adds.in>45&!variable.pooling_for_meta&buff.metamorphosis.down&(artifact.anguish_of_the_deceiver.enabled|active_enemies>1)))
# If Demonic is talented, pool fury as Eye Beam is coming off cooldown.
actions+=/demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<gcd&fury.deficit>=20
actions+=/demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<2*gcd&fury.deficit>=45
actions+=/throw_glaive,if=buff.metamorphosis.down&spell_targets>=2
actions+=/chaos_strike,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
# Use Fel Barrage if its nearing max charges, saving it for Momentum and adds if possible.
actions+=/fel_barrage,if=charges=4&buff.metamorphosis.down&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
actions+=/fel_rush,animation_cancel=1,if=!talent.momentum.enabled&raid_event.movement.in>charges*10
actions+=/demons_bite
actions+=/throw_glaive,if=buff.out_of_range.up|buff.raid_movement.up
actions+=/felblade,if=movement.distance|buff.out_of_range.up
actions+=/fel_rush,if=movement.distance>15|(buff.out_of_range.up&!talent.momentum.enabled)
actions+=/vengeful_retreat,if=movement.distance>15

actions.cooldown=nemesis,target_if=min:target.time_to_die,if=raid_event.adds.exists&debuff.nemesis.down&(active_enemies>desired_targets|raid_event.adds.in>60)
actions.cooldown+=/nemesis,if=!raid_event.adds.exists&(cooldown.metamorphosis.remains>100|target.time_to_die<70)
actions.cooldown+=/nemesis,sync=metamorphosis,if=!raid_event.adds.exists
actions.cooldown+=/chaos_blades,if=buff.metamorphosis.up|cooldown.metamorphosis.remains>100|target.time_to_die<20
actions.cooldown+=/metamorphosis,if=variable.pooling_for_meta&fury.deficit<30&(talent.chaos_blades.enabled|!cooldown.fury_of_the_illidari.ready)
actions.cooldown+=/potion,name=old_war,if=buff.metamorphosis.remains>25|target.time_to_die<30

head=vindictive_gladiators_felskin_helm,id=136289,bonus_id=3428/1676/1477/3336
neck=cursed_beartooth_necklace,id=139239,bonus_id=1807/1472
shoulders=manasaber_hide_shoulders,id=134330,bonus_id=3432/40/1497/1674
back=drape_of_the_manastarved,id=141543,bonus_id=1472
chest=scarred_ragefang_chestpiece,id=139208,bonus_id=1807/1472
wrists=wristwraps_of_broken_trust,id=139209,bonus_id=1807/1477/3336
hands=cruel_vice_grips,id=133617,bonus_id=1727/1512/3337
waist=forestlords_waistwrap,id=139198,bonus_id=1807/1487/3337
legs=splotched_bloodfur_leggings,id=139201,bonus_id=1807/1487/3337
feet=grove_darkeners_treads,id=134429,bonus_id=1727/1502/3336
finger1=ring_of_frozen_magic,id=141533,bonus_id=1482/3336
finger2=twicewarped_azsharan_signet,id=139238,bonus_id=1807/41/1472
trinket1=threetoed_rabbit_foot,id=134203,bonus_id=3432/603/1512/3337
trinket2=bloodthirsty_instinct,id=139329,bonus_id=1807/1808/1472
main_hand=twinblades_of_the_deceiver,id=127829,bonus_id=719,gem_id=141277/136719/141255/0,relic_id=3432:1497:1674/1727:1492:1813/3432:1502:3336/0
off_hand=twinblades_of_the_deceiver,id=127830

# Gear Summary
# gear_ilvl=855.81
# gear_agility=13392
# gear_stamina=19893
# gear_crit_rating=7213
# gear_haste_rating=3761
# gear_mastery_rating=5313
# gear_versatility_rating=921
# gear_leech_rating=314
# gear_avoidance_rating=397
# gear_armor=2045

Buuey

Buuey : 293226 dps, 174979 dps to main target

  • Race: Tauren
  • Class: Druid
  • Spec: Balance
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
293225.7 293225.7 357.9 / 0.122% 68795.7 / 23.5% 83405.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
3.5 3.5 Astral Power 8.86% 38.2 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Buuey/advanced
Talents
  • 15: Starlord (Balance Druid)
  • 30: Displacer Beast
  • 45: Guardian Affinity (Balance Druid)
  • 60: Typhoon
  • 75: Stellar Flare (Balance Druid)
  • 90: Blessing of the Ancients (Balance Druid)
  • 100: Nature's Balance (Balance Druid)
  • Talent Calculator
Artifact
Professions
  • leatherworking: 752
  • jewelcrafting: 720
Scale Factors for Buuey Damage Per Second
Haste Int Vers Crit Mastery
Scale Factors 8.62 8.30 7.31 6.99 4.08
Normalized 1.04 1.00 0.88 0.84 0.49
Scale Deltas 1138 1138 1138 1138 1138
Error 0.45 0.45 0.45 0.45 0.45
Gear Ranking
Optimizers
Ranking
  • Haste ~= Int > Vers ~= Crit > Mastery
Pawn string ( Pawn: v1: "Buuey": Intellect=8.30, CritRating=6.99, HasteRating=8.62, MasteryRating=4.08, Versatility=7.31 )

Scale Factors for other metrics

Scale Factors for Buuey Damage Per Second
Haste Int Vers Crit Mastery
Scale Factors 8.62 8.30 7.31 6.99 4.08
Normalized 1.04 1.00 0.88 0.84 0.49
Scale Deltas 1138 1138 1138 1138 1138
Error 0.45 0.45 0.45 0.45 0.45
Gear Ranking
Optimizers
Ranking
  • Haste ~= Int > Vers ~= Crit > Mastery
Pawn string ( Pawn: v1: "Buuey": Intellect=8.30, CritRating=6.99, HasteRating=8.62, MasteryRating=4.08, Versatility=7.31 )
Scale Factors for Buuey Priority Target Damage Per Second
Int Vers Crit Haste Mastery
Scale Factors 5.01 4.30 4.13 4.08 1.79
Normalized 1.00 0.86 0.82 0.81 0.36
Scale Deltas 1138 1138 1138 1138 1138
Error 0.14 0.14 0.14 0.13 0.14
Gear Ranking
Optimizers
Ranking
  • Int > Vers > Crit ~= Haste > Mastery
Pawn string ( Pawn: v1: "Buuey": Intellect=5.01, CritRating=4.13, HasteRating=4.08, MasteryRating=1.79, Versatility=4.30 )
Scale Factors for Buuey Damage Per Second (Effective)
Haste Int Vers Crit Mastery
Scale Factors 8.62 8.30 7.31 6.99 4.08
Normalized 1.04 1.00 0.88 0.84 0.49
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Haste > Int > Vers > Crit > Mastery
Pawn string ( Pawn: v1: "Buuey": Intellect=8.30, CritRating=6.99, HasteRating=8.62, MasteryRating=4.08, Versatility=7.31 )
Scale Factors for Buuey Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Buuey": )
Scale Factors for Buuey Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Buuey": )
Scale Factors for Buuey Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Buuey": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Buuey": )
Scale Factors for Buuey Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Buuey": )
Scale Factors for Buuey Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Buuey": )
Scale Factors for Buuey Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Buuey": )
Scale Factors for Buuey Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Buuey": )
Scale Factors for BuueyTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Buuey": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Buuey 293226
Deadly Grace 8210 2.8% 25.3 9.14sec 128430 0 Direct 25.1 105406 215121 129473 21.9%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.26 25.06 0.00 0.00 0.0000 0.0000 3244388.56 3244388.56 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.56 78.07% 105406.17 88906 115578 105403.93 96180 113526 2061962 2061962 0.00
crit 5.50 21.93% 215120.55 181369 235779 214436.97 0 235779 1182427 1182427 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Full Moon 18062 6.2% 7.7 54.56sec 937287 368506 Direct 16.9 348217 711358 427875 21.9%  

Stats details: full_moon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.70 16.87 0.00 0.00 2.5435 0.0000 7218297.30 5668204.75 -27.35 368506.09 368506.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.17 78.07% 348217.19 112498 674988 351484.67 112498 618739 4586105 3603842 -28.80
crit 3.70 21.93% 711358.39 229496 1376976 703880.05 0 1376976 2632193 2064363 -42.88
 
 

Action details: full_moon

Static Values
  • id:202771
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.9000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(charges=2&recharge_time<5)|charges=3|target.time_to_die<15
Spelldata
  • id:202771
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals $m1 Astral damage to the target and reduced damage to all other nearby enemies, and resets Full Moon to become New Moon. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:18.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Half Moon 8312 2.9% 8.1 52.05sec 413456 231548 Direct 8.0 337495 688489 414996 22.1%  

Stats details: half_moon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.05 8.03 0.00 0.00 1.7857 0.0000 3330350.49 3330350.49 0.00 231547.69 231547.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.25 77.92% 337494.75 337495 337495 337494.75 337495 337495 2110363 2110363 0.00
crit 1.77 22.08% 688489.28 688489 688489 591953.43 0 688489 1219987 1219987 0.00
 
 

Action details: half_moon

Static Values
  • id:202768
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(charges=2&recharge_time<5)|charges=3|(target.time_to_die<15&charges=2)
Spelldata
  • id:202768
  • name:Half Moon
  • school:arcane
  • tooltip:
  • description:Deals $m1 Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lunar Strike 58019 19.7% 56.1 6.75sec 409949 201311 Direct 270.3 61457 125291 85014 36.9%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.05 270.30 0.00 0.00 2.0364 0.0000 22979276.90 22979276.90 0.00 201311.25 201311.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 170.55 63.10% 61456.69 39511 244140 61471.12 52510 70906 10481439 10481439 0.00
crit 99.75 36.90% 125291.06 80602 498046 125329.00 98251 155397 12497838 12497838 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.15
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lunar_empowerment.stack=3
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 284.0%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.840000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Moonfire 21127 7.2% 18.8 22.03sec 449387 354742 Direct 18.8 50056 102140 61471 21.9%  
Periodic 241.9 24586 50156 30198 21.9% 99.8%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.83 18.83 241.94 241.94 1.2668 1.6539 8464151.05 8464151.05 0.00 19962.24 354742.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.71 78.08% 50055.66 45375 109876 50091.77 45375 63429 736172 736172 0.00
crit 4.13 21.92% 102140.13 92566 224147 101226.55 0 224147 421616 421616 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 188.8 78.05% 24585.89 8708 54939 24597.30 23710 25614 4642753 4642753 0.00
crit 53.1 21.95% 50156.14 17764 112076 50179.33 46516 57446 2663611 2663611 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.natures_balance.enabled&remains<3)|(remains<6.6&!talent.natures_balance.enabled)
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=1 + 110.0%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s5487=true}[ Usable while in Bear Form.][]{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
New Moon 4322 1.5% 7.4 54.26sec 234470 175753 Direct 8.4 168748 344246 207250 21.9%  

Stats details: new_moon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.39 8.36 0.00 0.00 1.3341 0.0000 1732393.06 1732393.06 0.00 175752.57 175752.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.53 78.07% 168747.93 168748 168748 168747.93 168748 168748 1101224 1101224 0.00
crit 1.83 21.93% 344245.79 344246 344246 299489.36 0 344246 631169 631169 0.00
 
 

Action details: new_moon

Static Values
  • id:202767
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202767
  • name:New Moon
  • school:arcane
  • tooltip:
  • description:Deals $m1 Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Solar Wrath 22372 7.8% 70.1 5.65sec 130781 101370 Direct 69.4 107497 219411 132063 22.0%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.05 69.37 0.00 0.00 1.2901 0.0000 9161444.47 9161444.47 0.00 101370.32 101370.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.14 78.05% 107497.13 91425 197722 108804.56 97778 143036 5820234 5820234 0.00
crit 15.23 21.95% 219411.33 186506 403353 222000.94 0 356813 3341210 3341210 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack=3
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=1} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Starfall 49349 (58075) 16.7% (19.6%) 15.3 21.76sec 1496974 1207235 Periodic 651.1 24402 49786 29957 21.9% 0.0%

Stats details: starfall

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.33 0.00 0.00 651.14 1.2400 0.0000 19506339.06 19506339.06 0.00 1207234.71 1207234.71
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 508.6 78.12% 24402.27 24149 31394 24398.79 24149 25486 12411883 12411883 0.00
crit 142.5 21.88% 49785.78 49264 64043 49778.41 49264 52408 7094456 7094456 0.00
 
 

Action details: starfall

Static Values
  • id:191034
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.oneths_overconfidence.up
Spelldata
  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars at the targeted area.
  • description:Calls down waves of falling stars at the targeted area, dealing ${9*$191037m1} Astral damage over {$191034d=8 seconds}.$?a231049[ Also applies Stellar Empowerment to each target, which increases damage taken from your Moonfire and Sunfire by {$197637s1=20}%.][]
 
    Echoing Stars 8726 2.9% 0.0 0.00sec 0 0 Periodic 604.0 4647 9479 5707 21.9% 0.0%

Stats details: echoing_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 603.97 0.0000 0.0000 3446814.47 3446814.47 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 471.5 78.06% 4646.91 4610 5993 4646.14 4610 4873 2190942 2190942 0.00
crit 132.5 21.94% 9479.47 9405 12226 9477.89 9405 10058 1255873 1255873 0.00
 
 

Action details: echoing_stars

Static Values
  • id:226104
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:226104
  • name:Echoing Stars
  • school:astral
  • tooltip:
  • description:$@spelldesc48505
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.084000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Starsurge 12657 (14845) 4.3% (5.1%) 13.7 29.23sec 433536 344040 Direct 13.7 261882 534399 370568 39.9%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.73 13.70 0.00 0.00 1.2602 0.0000 5075745.05 5075745.05 0.00 344039.85 344039.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.23 60.12% 261882.26 246979 321073 261812.43 0 321073 2156371 2156371 0.00
crit 5.46 39.88% 534398.70 503838 654990 533136.08 0 654990 2919374 2919374 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.18
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=2
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=1} Astral damage. Also grants you Lunar and Solar Empowerments, which increase the damage of your next Lunar Strike and Solar Wrath by {$164547s1=20}%, respectively.$?a231021[ You can accumulate up to {$164547u=1} of each Empowerment.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Goldrinn's Fang 2188 0.8% 4.5 69.98sec 194816 0 Direct 4.5 159109 324575 195531 22.0%  

Stats details: goldrinns_fang

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.50 4.49 0.00 0.00 0.0000 0.0000 877520.47 877520.47 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.50 77.99% 159109.08 149997 194996 154877.45 0 194996 556868 556868 0.00
crit 0.99 22.01% 324574.98 305994 397792 203522.72 0 397792 320653 320653 0.00
 
 

Action details: goldrinns_fang

Static Values
  • id:203001
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:203001
  • name:Goldrinn's Fang
  • school:arcane
  • tooltip:Deals $m1 Arcane damage.
  • description:Deals $m1 Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Stellar Flare 18973 6.5% 14.2 29.19sec 538247 416022 Direct 14.2 76378 155726 93822 22.0%  
Periodic 202.5 25320 51671 31094 21.9% 80.6%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.17 14.17 202.50 202.50 1.2938 1.5957 7625674.35 7625674.35 0.00 22332.75 416021.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.05 78.02% 76378.04 75000 97500 76366.59 75000 82500 844219 844219 0.00
crit 3.11 21.98% 155726.34 152999 198899 150098.00 0 198899 484995 484995 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 158.1 78.09% 25320.15 2060 59025 25318.33 23833 26734 4003885 4003885 0.00
crit 44.4 21.91% 51670.79 4202 120412 51662.11 42840 64721 2292575 2292575 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:15.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<4&remains<7.2&astral_power>=15
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=1} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. Stellar Flare benefits from Starfall's Stellar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.650000
  • base_td:1.00
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Sunfire 48796 16.6% 15.2 23.64sec 1271682 1022472 Direct 66.7 47955 97861 58893 21.9%  
Periodic 519.1 24246 49432 29762 21.9% 214.8%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.24 66.74 519.14 519.14 1.2438 1.6594 19380965.67 19380965.67 0.00 22013.27 1022472.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.11 78.08% 47955.42 44138 106879 47910.76 44138 59436 2498983 2498983 0.00
crit 14.63 21.92% 97861.50 90041 218033 97731.74 90041 141336 1431507 1431507 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 405.5 78.10% 24246.18 39 53441 24254.54 23125 25669 9830622 9830622 0.00
crit 113.7 21.90% 49431.87 106 109020 49446.97 45951 54409 5619853 5619853 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.natures_balance.enabled&remains<3)|(remains<5.4&!talent.natures_balance.enabled)
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=1} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Tormenting Cyclone 12113 4.1% 13.7 28.36sec 350998 0 Direct 324.3 12070 24626 14822 21.9%  

Stats details: tormenting_cyclone

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.70 324.31 0.00 0.00 0.0000 0.0000 4807006.05 4807006.05 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 253.23 78.08% 12069.77 11847 15401 12073.61 11847 13638 3056380 3056380 0.00
crit 71.09 21.92% 24626.46 24168 31418 24635.54 24168 29347 1750626 1750626 0.00
 
 

Action details: tormenting_cyclone

Static Values
  • id:221857
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221857
  • name:Tormenting Cyclone
  • school:shadow
  • tooltip:
  • description:{$@spelldesc221845=Your ranged attacks and spells have a chance to create a Tormenting Cyclone at the target's location for {$221857d=10 seconds} that deals {$s1=7995} Shadow damage every sec.}
 
Simple Action Stats Execute Interval
Buuey
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Buuey
  • harmful:false
  • if_expr:
 
Blessing of Elune 1.0 0.00sec

Stats details: blessing_of_elune

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: blessing_of_elune

Static Values
  • id:202737
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:202737
  • name:Blessing of Elune
  • school:arcane
  • tooltip:Astral Power generated by Solar Wrath and Lunar Strike increased by {$s1=25}%.
  • description:Increases Astral Power generated by Solar Wrath and Lunar Strike by {$s1=25}%.
 
Celestial Alignment 2.5 191.64sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.52 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Lunar and Solar spells damage increased by {$s1=30}%. Lunar Strike and Solar Wrath generate {$s3=50}% additional Astral Power.
  • description:Celestial bodies align, increasing the damage of all your spells by {$s1=30}%, and increasing the Astral Power generated by Lunar Strike and Solar Wrath by {$s3=50}%. Lasts {$d=15 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Buuey
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Buuey
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Arcane and Nature damage done increased by {$s8=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing your Arcane and Nature damage by {$s8=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance make your next Lunar Strike, Solar Wrath or Stellar Flare instant.][] The act of shapeshifting frees you from movement impairing effects.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.12% 33.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 2.5 0.0 191.6sec 191.6sec 9.20% 9.20% 0.0(0.0) 2.4

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • celestial_alignment_1:9.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Lunar and Solar spells damage increased by {$s1=30}%. Lunar Strike and Solar Wrath generate {$s3=50}% additional Astral Power.
  • description:Celestial bodies align, increasing the damage of all your spells by {$s1=30}%, and increasing the Astral Power generated by Lunar Strike and Solar Wrath by {$s3=50}%. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Lunar Empowerment 11.7 2.0 34.7sec 29.3sec 20.65% 20.50% 2.0(2.0) 0.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_lunar_empowerment
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • lunar_empowerment_1:20.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:The damage of your next Lunar Strike is increased by $w1%$?$w2>0[, and its cast time is reduced by $w2%][].
  • description:Increases the damage of your next Lunar Strike within {$d=40 seconds} by {$s1=20}%.
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Oneth's Intuition 2.9 0.1 74.8sec 69.8sec 7.45% 20.70% 0.1(0.1) 0.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_oneths_intuition
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00

Stack Uptimes

  • oneths_intuition_1:7.45%

Trigger Attempt Success

  • trigger_pct:20.02%

Spelldata details

  • id:209406
  • name:Oneth's Intuition
  • tooltip:Your next Starsurge costs no Astral Power.
  • description:{$@spelldesc209405=Starsurge and Starfall each have a {$s1=20}% chance to make the other free.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Oneth's Overconfidence 2.7 0.0 87.4sec 87.4sec 0.97% 17.02% 0.0(0.0) 0.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_oneths_overconfidence
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00

Stack Uptimes

  • oneths_overconfidence_1:0.97%

Trigger Attempt Success

  • trigger_pct:19.63%

Spelldata details

  • id:209407
  • name:Oneth's Overconfidence
  • tooltip:Your next Starfall costs no Astral Power.
  • description:{$@spelldesc209405=Starsurge and Starfall each have a {$s1=20}% chance to make the other free.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 191.5sec 0.0sec 12.15% 12.15% 0.0(0.0) 2.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:12.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 14.53% 14.53% 2.0(2.0) 0.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.53%

Trigger Attempt Success

  • trigger_pct:100.00%
Solar Empowerment 11.9 1.8 34.0sec 29.3sec 13.88% 18.40% 1.8(1.8) 0.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_solar_empowerment
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • solar_empowerment_1:13.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:The damage of your next Solar Wrath is increased by $w1%$?$w2>0[, and its cast time is reduced by $w2%][].
  • description:Increases the damage of your next Solar Wrath within {$d=40 seconds} by {$s1=20}%.
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Blessing of Elune

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_blessing_of_elune
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • blessing_of_elune_1:100.00%

Spelldata details

  • id:202737
  • name:Blessing of Elune
  • tooltip:Astral Power generated by Solar Wrath and Lunar Strike increased by {$s1=25}%.
  • description:Increases Astral Power generated by Solar Wrath and Lunar Strike by {$s1=25}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Arcane and Nature damage done increased by {$s8=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing your Arcane and Nature damage by {$s8=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance make your next Lunar Strike, Solar Wrath or Stellar Flare instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Buuey
starfall Astral Power 15.3 756.5 49.3 49.3 30339.6
starsurge Astral Power 13.7 431.9 31.5 31.5 13782.4
stellar_flare Astral Power 14.2 212.5 15.0 15.0 35883.3
Resource Gains Type Count Total Average Overflow
new_moon Astral Power 8.39 83.89 (5.90%) 10.00 0.00 0.00%
half_moon Astral Power 8.05 161.10 (11.34%) 20.00 0.00 0.00%
full_moon Astral Power 7.70 308.05 (21.68%) 40.00 0.00 0.00%
lunar_strike Astral Power 56.05 867.61 (61.07%) 15.48 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 3.54 3.49
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.46 0.00 77.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Buuey Fight Length
Count 9999
Mean 401.00
Minimum 308.02
Maximum 501.87
Spread ( max - min ) 193.85
Range [ ( max - min ) / 2 * 100% ] 24.17%
DPS
Sample Data Buuey Damage Per Second
Count 9999
Mean 293225.71
Minimum 250223.45
Maximum 361657.41
Spread ( max - min ) 111433.96
Range [ ( max - min ) / 2 * 100% ] 19.00%
Standard Deviation 18261.1538
5th Percentile 267237.08
95th Percentile 326252.59
( 95th Percentile - 5th Percentile ) 59015.51
Mean Distribution
Standard Deviation 182.6207
95.00% Confidence Intervall ( 292867.78 - 293583.64 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 148
0.1% Error 14898
0.1 Scale Factor Error with Delta=300 2846689
0.05 Scale Factor Error with Delta=300 11386757
0.01 Scale Factor Error with Delta=300 284668948
Priority Target DPS
Sample Data Buuey Priority Target Damage Per Second
Count 9999
Mean 174978.85
Minimum 156937.01
Maximum 197412.90
Spread ( max - min ) 40475.89
Range [ ( max - min ) / 2 * 100% ] 11.57%
Standard Deviation 5499.7488
5th Percentile 166211.94
95th Percentile 184282.15
( 95th Percentile - 5th Percentile ) 18070.21
Mean Distribution
Standard Deviation 55.0002
95.00% Confidence Intervall ( 174871.05 - 175086.65 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3794
0.1 Scale Factor Error with Delta=300 258207
0.05 Scale Factor Error with Delta=300 1032831
0.01 Scale Factor Error with Delta=300 25820781
DPS(e)
Sample Data Buuey Damage Per Second (Effective)
Count 9999
Mean 293225.71
Minimum 250223.45
Maximum 361657.41
Spread ( max - min ) 111433.96
Range [ ( max - min ) / 2 * 100% ] 19.00%
Damage
Sample Data Buuey Damage
Count 9999
Mean 116850366.95
Minimum 92489198.04
Maximum 143277916.66
Spread ( max - min ) 50788718.62
Range [ ( max - min ) / 2 * 100% ] 21.73%
DTPS
Sample Data Buuey Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Buuey Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Buuey Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Buuey Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Buuey Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Buuey Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data BuueyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Buuey Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 moonkin_form
4 0.00 blessing_of_elune
5 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
6 0.00 potion,name=deadly_grace
7 0.00 new_moon
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,name=deadly_grace,if=buff.celestial_alignment.up|buff.incarnation.up
0.00 blessing_of_elune,if=active_enemies<=2&talent.blessing_of_the_ancients.enabled&buff.blessing_of_elune.down
0.00 blessing_of_elune,if=active_enemies>=3&talent.blessing_of_the_ancients.enabled&buff.blessing_of_anshe.down
0.00 blood_fury,if=buff.celestial_alignment.up|buff.incarnation.up
0.00 berserking,if=buff.celestial_alignment.up|buff.incarnation.up
0.00 arcane_torrent,if=buff.celestial_alignment.up|buff.incarnation.up
9 0.00 call_action_list,name=fury_of_elune,if=talent.fury_of_elune.enabled&cooldown.fury_of_elue.remains<target.time_to_die
A 0.00 call_action_list,name=ed,if=equipped.the_emerald_dreamcatcher
0.00 new_moon,if=(charges=2&recharge_time<5)|charges=3
0.00 half_moon,if=(charges=2&recharge_time<5)|charges=3|(target.time_to_die<15&charges=2)
B 0.34 full_moon,if=(charges=2&recharge_time<5)|charges=3|target.time_to_die<15
C 15.23 stellar_flare,cycle_targets=1,max_cycle_targets=4,if=active_enemies<4&remains<7.2&astral_power>=15
D 18.83 moonfire,if=(talent.natures_balance.enabled&remains<3)|(remains<6.6&!talent.natures_balance.enabled)
E 15.24 sunfire,if=(talent.natures_balance.enabled&remains<3)|(remains<5.4&!talent.natures_balance.enabled)
0.00 astral_communion,if=astral_power.deficit>=75
0.00 incarnation,if=astral_power>=40
F 2.52 celestial_alignment,if=astral_power>=40
G 2.72 starfall,if=buff.oneths_overconfidence.up
0.00 solar_wrath,if=buff.solar_empowerment.stack=3
0.00 lunar_strike,if=buff.lunar_empowerment.stack=3
H 0.00 call_action_list,name=celestial_alignment_phase,if=buff.celestial_alignment.up|buff.incarnation.up
I 0.00 call_action_list,name=single_target
actions.celestial_alignment_phase
# count action,conditions
J 0.51 starfall,if=(active_enemies>=2&talent.stellar_flare.enabled|active_enemies>=3)&((talent.fury_of_elune.enabled&cooldown.fury_of_elune.remains>12&buff.fury_of_elune_up.down)|!talent.fury_of_elune.enabled)
K 2.77 starsurge,if=active_enemies<=2
0.00 warrior_of_elune
0.00 lunar_strike,if=buff.warrior_of_elune.up
L 3.12 solar_wrath,if=buff.solar_empowerment.up
M 2.62 lunar_strike,if=buff.lunar_empowerment.up
0.00 solar_wrath,if=talent.natures_balance.enabled&dot.sunfire_dmg.remains<5&cast_time<dot.sunfire_dmg.remains
N 1.73 lunar_strike,if=(talent.natures_balance.enabled&dot.moonfire_dmg.remains<5&cast_time<dot.moonfire_dmg.remains)|active_enemies>=2
O 12.42 solar_wrath
actions.single_target
# count action,conditions
P 8.19 new_moon,if=astral_power<=90
Q 10.80 half_moon,if=astral_power<=80
R 8.82 full_moon,if=astral_power<=60
S 12.10 starfall,if=(active_enemies>=2&talent.stellar_flare.enabled|active_enemies>=3)&((talent.fury_of_elune.enabled&cooldown.fury_of_elune.remains>12&buff.fury_of_elune_up.down)|!talent.fury_of_elune.enabled)
T 10.96 starsurge,if=active_enemies<=2
0.00 warrior_of_elune
0.00 lunar_strike,if=buff.warrior_of_elune.up
U 11.16 solar_wrath,if=buff.solar_empowerment.up
V 10.61 lunar_strike,if=buff.lunar_empowerment.up
0.00 solar_wrath,if=talent.natures_balance.enabled&dot.sunfire_dmg.remains<5&cast_time<dot.sunfire_dmg.remains
W 49.50 lunar_strike,if=(talent.natures_balance.enabled&dot.moonfire_dmg.remains<5&cast_time<dot.moonfire_dmg.remains)|active_enemies>=2
X 53.95 solar_wrath

Sample Sequence

0123467DEQCRFKLMOOOOOOOOODPWSWWQWWESWWCDXRTUEUVWWPSDWWWCEXQXXXWDWSQWWEWCXXXQDTUVWWRESWWDCTUVPXXWWESWWDQWWSXXXXRCXEWDWSWPWWF8JENCKLDMOOQWWSEQWWDWTUVCRTEUVVWDPWSWWCECQTUVDVWWWERSWWCTDGPUVEWWWQSWDWECXXXRTUVTUVDXCPXXXXXXXXXXPXDXXXCXXXXQXXXXXXXDXXRCFKLMOOOOOOOODP

Sample Sequence Table

time name target resources buffs
Pre flask Buuey 0.0/100: 0% astral_power | 0.0/100: 0% rage
Pre food Buuey 0.0/100: 0% astral_power | 0.0/100: 0% rage
Pre augmentation Buuey 0.0/100: 0% astral_power | 0.0/100: 0% rage
Pre moonkin_form Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage
Pre blessing_of_elune Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage
Pre potion Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
0:00.000 new_moon Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
0:00.000 moonfire Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
0:01.218 sunfire Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage bloodlust, potion_of_deadly_grace
0:02.205 half_moon Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage bloodlust, potion_of_deadly_grace
0:03.519 stellar_flare Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage bloodlust, potion_of_deadly_grace
0:04.506 full_moon Fluffy_Pillow 15.0/100: 15% astral_power | 0.0/100: 0% rage bloodlust, potion_of_deadly_grace
0:06.476 celestial_alignment Fluffy_Pillow 55.0/100: 55% astral_power | 0.0/100: 0% rage bloodlust, potion_of_deadly_grace
0:06.476 starsurge Fluffy_Pillow 55.0/100: 55% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:07.464 solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, potion_of_deadly_grace
0:08.254 lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, lunar_empowerment, potion_of_deadly_grace
0:09.569 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:10.558 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:11.545 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:12.533 Waiting 0.700 sec 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, raid_movement, celestial_alignment, potion_of_deadly_grace
0:13.233 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:14.220 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:15.207 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:16.195 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:17.180 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:18.168 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:19.156 moonfire Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, celestial_alignment, potion_of_deadly_grace
0:20.142 Waiting 3.500 sec 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust, raid_movement, celestial_alignment, potion_of_deadly_grace
0:23.642 new_moon Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust
0:24.631 lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power | 0.0/100: 0% rage bloodlust
0:26.275 starfall Fluffy_Pillow 62.5/100: 63% astral_power | 0.0/100: 0% rage bloodlust
0:27.262 lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage bloodlust
0:28.250 Waiting 0.900 sec 2.5/100: 3% astral_power | 0.0/100: 0% rage bloodlust, raid_movement
0:29.150 lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage bloodlust
0:30.793 half_moon Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage bloodlust
0:32.108 lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust
0:33.752 lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power | 0.0/100: 0% rage bloodlust
0:35.395 sunfire Fluffy_Pillow 67.5/100: 68% astral_power | 0.0/100: 0% rage bloodlust
0:36.384 starfall Fluffy_Pillow 67.5/100: 68% astral_power | 0.0/100: 0% rage bloodlust
0:37.373 lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power | 0.0/100: 0% rage bloodlust
0:39.015 lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage bloodlust
0:40.659 stellar_flare Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage bloodlust
0:41.839 moonfire Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
0:43.121 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
0:44.403 Waiting 0.800 sec 22.5/100: 23% astral_power | 0.0/100: 0% rage raid_movement
0:45.203 full_moon Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
0:47.764 starsurge Fluffy_Pillow 62.5/100: 63% astral_power | 0.0/100: 0% rage
0:49.046 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
0:50.071 Waiting 2.200 sec 22.5/100: 23% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment, solar_empowerment
0:52.271 sunfire Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment, solar_empowerment
0:53.554 Waiting 0.100 sec 22.5/100: 23% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment, solar_empowerment
0:53.654 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
0:54.681 lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage lunar_empowerment
0:56.388 lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage
0:58.521 lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power | 0.0/100: 0% rage
1:00.005 Waiting 1.200 sec 52.5/100: 53% astral_power | 0.0/100: 0% rage raid_movement
1:01.205 new_moon Fluffy_Pillow 52.5/100: 53% astral_power | 0.0/100: 0% rage
1:02.486 starfall Fluffy_Pillow 62.5/100: 63% astral_power | 0.0/100: 0% rage
1:03.768 moonfire Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage
1:05.051 lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage
1:07.186 lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
1:09.320 lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
1:11.454 stellar_flare Fluffy_Pillow 47.5/100: 48% astral_power | 0.0/100: 0% rage
1:12.736 sunfire Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
1:14.018 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
1:15.301 half_moon Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
1:16.582 Waiting 0.600 sec 32.5/100: 33% astral_power | 0.0/100: 0% rage raid_movement
1:17.182 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
1:18.465 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
1:19.750 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
1:21.035 Waiting 2.600 sec 32.5/100: 33% astral_power | 0.0/100: 0% rage raid_movement
1:23.635 lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
1:25.768 moonfire Fluffy_Pillow 47.5/100: 48% astral_power | 0.0/100: 0% rage
1:27.050 lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power | 0.0/100: 0% rage
1:29.185 starfall Fluffy_Pillow 62.5/100: 63% astral_power | 0.0/100: 0% rage
1:30.469 half_moon Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage
1:32.004 Waiting 1.200 sec 2.5/100: 3% astral_power | 0.0/100: 0% rage raid_movement
1:33.204 lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage
1:35.338 lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
1:37.474 sunfire Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
1:38.755 lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
1:40.890 stellar_flare Fluffy_Pillow 47.5/100: 48% astral_power | 0.0/100: 0% rage
1:42.172 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
1:43.455 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
1:44.738 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
1:46.020 half_moon Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
1:47.730 moonfire Fluffy_Pillow 52.5/100: 53% astral_power | 0.0/100: 0% rage
1:49.014 starsurge Fluffy_Pillow 52.5/100: 53% astral_power | 0.0/100: 0% rage raid_movement
1:50.296 Waiting 3.300 sec 12.5/100: 13% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment, solar_empowerment
1:53.596 solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:54.620 lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment
1:56.330 lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
1:58.465 lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power | 0.0/100: 0% rage
2:00.600 full_moon Fluffy_Pillow 57.5/100: 57% astral_power | 0.0/100: 0% rage
2:03.160 sunfire Fluffy_Pillow 97.5/100: 98% astral_power | 0.0/100: 0% rage
2:04.443 starfall Fluffy_Pillow 97.5/100: 98% astral_power | 0.0/100: 0% rage raid_movement
2:05.725 lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage
2:07.860 lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power | 0.0/100: 0% rage
2:09.995 moonfire Fluffy_Pillow 67.5/100: 68% astral_power | 0.0/100: 0% rage
2:11.277 stellar_flare Fluffy_Pillow 67.5/100: 68% astral_power | 0.0/100: 0% rage
2:12.560 starsurge Fluffy_Pillow 52.5/100: 53% astral_power | 0.0/100: 0% rage
2:13.841 solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:14.868 lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment
2:16.577 new_moon Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
2:17.862 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage
2:19.146 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage
2:20.428 Waiting 0.200 sec 37.5/100: 38% astral_power | 0.0/100: 0% rage raid_movement
2:20.628 lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage
2:22.762 lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power | 0.0/100: 0% rage
2:24.898 sunfire Fluffy_Pillow 67.5/100: 68% astral_power | 0.0/100: 0% rage
2:26.181 starfall Fluffy_Pillow 67.5/100: 68% astral_power | 0.0/100: 0% rage
2:27.462 lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power | 0.0/100: 0% rage
2:29.596 lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
2:31.730 moonfire Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage
2:33.012 half_moon Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage
2:34.720 lunar_strike Fluffy_Pillow 57.5/100: 57% astral_power | 0.0/100: 0% rage
2:36.005 Waiting 1.200 sec 57.5/100: 57% astral_power | 0.0/100: 0% rage raid_movement
2:37.205 lunar_strike Fluffy_Pillow 57.5/100: 57% astral_power | 0.0/100: 0% rage
2:39.339 starfall Fluffy_Pillow 72.5/100: 73% astral_power | 0.0/100: 0% rage
2:40.623 solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage
2:41.906 solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage
2:43.188 solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage
2:44.471 solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage
2:45.754 full_moon Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage
2:48.313 stellar_flare Fluffy_Pillow 52.5/100: 53% astral_power | 0.0/100: 0% rage
2:49.595 solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage
2:50.877 sunfire Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage raid_movement
2:52.161 Waiting 0.500 sec 37.5/100: 38% astral_power | 0.0/100: 0% rage raid_movement
2:52.661 lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage
2:54.795 moonfire Fluffy_Pillow 52.5/100: 53% astral_power | 0.0/100: 0% rage
2:56.078 lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power | 0.0/100: 0% rage
2:58.210 starfall Fluffy_Pillow 67.5/100: 68% astral_power | 0.0/100: 0% rage
2:59.492 lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power | 0.0/100: 0% rage oneths_intuition
3:01.628 new_moon Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage oneths_intuition
3:02.912 lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage oneths_intuition
3:05.046 lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power | 0.0/100: 0% rage oneths_intuition
3:07.179 celestial_alignment Fluffy_Pillow 62.5/100: 63% astral_power | 0.0/100: 0% rage oneths_intuition
3:07.179 potion Fluffy_Pillow 62.5/100: 63% astral_power | 0.0/100: 0% rage celestial_alignment, oneths_intuition
3:07.179 starfall Fluffy_Pillow 62.5/100: 63% astral_power | 0.0/100: 0% rage celestial_alignment, oneths_intuition, potion_of_deadly_grace
3:08.461 sunfire Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage raid_movement, celestial_alignment, oneths_intuition, potion_of_deadly_grace
3:09.744 lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage celestial_alignment, oneths_intuition, potion_of_deadly_grace
3:11.879 stellar_flare Fluffy_Pillow 25.0/100: 25% astral_power | 0.0/100: 0% rage celestial_alignment, oneths_intuition, potion_of_deadly_grace
3:13.161 starsurge Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage celestial_alignment, oneths_intuition, potion_of_deadly_grace
3:14.444 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, solar_empowerment, potion_of_deadly_grace
3:15.471 moonfire Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, potion_of_deadly_grace
3:16.755 lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, potion_of_deadly_grace
3:18.462 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage celestial_alignment, potion_of_deadly_grace
3:19.744 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage celestial_alignment, potion_of_deadly_grace
3:21.027 Waiting 2.600 sec 32.5/100: 33% astral_power | 0.0/100: 0% rage raid_movement, celestial_alignment, potion_of_deadly_grace
3:23.627 half_moon Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
3:24.910 Waiting 0.300 sec 32.5/100: 33% astral_power | 0.0/100: 0% rage raid_movement, potion_of_deadly_grace
3:25.210 lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
3:27.343 lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
3:29.479 starfall Fluffy_Pillow 62.5/100: 63% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
3:30.762 sunfire Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
3:32.042 half_moon Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
3:33.749 lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
3:35.882 lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage
3:38.018 moonfire Fluffy_Pillow 52.5/100: 53% astral_power | 0.0/100: 0% rage
3:39.300 lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power | 0.0/100: 0% rage
3:40.582 starsurge Fluffy_Pillow 52.5/100: 53% astral_power | 0.0/100: 0% rage raid_movement
3:41.863 solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
3:42.887 lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment
3:44.596 stellar_flare Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
3:45.878 full_moon Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage
3:48.437 starsurge Fluffy_Pillow 52.5/100: 53% astral_power | 0.0/100: 0% rage
3:49.720 sunfire Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
3:51.001 Waiting 2.600 sec 12.5/100: 13% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment, solar_empowerment
3:53.601 solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
3:54.627 lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment
3:56.005 Waiting 1.200 sec 12.5/100: 13% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment
3:57.205 lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment
3:58.914 lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
4:01.046 moonfire Fluffy_Pillow 42.5/100: 43% astral_power | 0.0/100: 0% rage
4:02.329 new_moon Fluffy_Pillow 42.5/100: 43% astral_power | 0.0/100: 0% rage
4:03.612 lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power | 0.0/100: 0% rage
4:05.746 starfall Fluffy_Pillow 67.5/100: 68% astral_power | 0.0/100: 0% rage
4:07.028 lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power | 0.0/100: 0% rage
4:09.163 lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
4:11.297 stellar_flare Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage
4:12.578 sunfire Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage raid_movement
4:13.861 stellar_flare Fluffy_Pillow 37.5/100: 38% astral_power | 0.0/100: 0% rage
4:15.146 half_moon Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
4:16.855 starsurge Fluffy_Pillow 42.5/100: 43% astral_power | 0.0/100: 0% rage
4:18.137 solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
4:19.163 lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage lunar_empowerment
4:20.190 Waiting 0.900 sec 2.5/100: 3% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment
4:21.090 moonfire Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment
4:22.371 Waiting 1.300 sec 2.5/100: 3% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment
4:23.671 lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage lunar_empowerment
4:25.380 lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
4:27.516 lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
4:28.799 Waiting 0.400 sec 32.5/100: 33% astral_power | 0.0/100: 0% rage raid_movement
4:29.199 lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
4:31.332 sunfire Fluffy_Pillow 47.5/100: 48% astral_power | 0.0/100: 0% rage
4:32.614 full_moon Fluffy_Pillow 47.5/100: 48% astral_power | 0.0/100: 0% rage
4:35.174 starfall Fluffy_Pillow 87.5/100: 88% astral_power | 0.0/100: 0% rage
4:36.457 lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
4:38.592 lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power | 0.0/100: 0% rage
4:40.727 stellar_flare Fluffy_Pillow 57.5/100: 57% astral_power | 0.0/100: 0% rage
4:42.010 starsurge Fluffy_Pillow 42.5/100: 43% astral_power | 0.0/100: 0% rage
4:43.293 moonfire Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment, oneths_overconfidence
4:44.575 starfall Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment, solar_empowerment, oneths_overconfidence
4:45.858 new_moon Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
4:47.141 solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
4:48.167 lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power | 0.0/100: 0% rage lunar_empowerment
4:49.876 sunfire Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
4:51.157 Waiting 2.500 sec 27.5/100: 28% astral_power | 0.0/100: 0% rage raid_movement
4:53.657 lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power | 0.0/100: 0% rage
4:55.791 lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power | 0.0/100: 0% rage
4:57.925 lunar_strike Fluffy_Pillow 57.5/100: 57% astral_power | 0.0/100: 0% rage
5:00.003 Waiting 1.200 sec 57.5/100: 57% astral_power | 0.0/100: 0% rage raid_movement
5:01.203 half_moon Fluffy_Pillow 57.5/100: 57% astral_power | 0.0/100: 0% rage
5:02.911 starfall Fluffy_Pillow 77.5/100: 78% astral_power | 0.0/100: 0% rage
5:04.191 lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
5:06.325 moonfire Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
5:07.608 lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
5:09.744 sunfire Fluffy_Pillow 47.5/100: 48% astral_power | 0.0/100: 0% rage
5:11.027 stellar_flare Fluffy_Pillow 47.5/100: 48% astral_power | 0.0/100: 0% rage
5:12.308 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
5:13.591 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
5:14.873 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
5:16.156 Waiting 1.000 sec 32.5/100: 33% astral_power | 0.0/100: 0% rage raid_movement
5:17.156 full_moon Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage
5:19.718 starsurge Fluffy_Pillow 72.5/100: 73% astral_power | 0.0/100: 0% rage
5:21.001 solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
5:22.028 lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power | 0.0/100: 0% rage lunar_empowerment
5:23.738 starsurge Fluffy_Pillow 47.5/100: 48% astral_power | 0.0/100: 0% rage
5:25.021 solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
5:26.048 lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power | 0.0/100: 0% rage lunar_empowerment
5:27.758 moonfire Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
5:29.041 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
5:30.324 stellar_flare Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
5:31.606 new_moon Fluffy_Pillow 7.5/100: 8% astral_power | 0.0/100: 0% rage
5:32.889 Waiting 0.300 sec 7.5/100: 8% astral_power | 0.0/100: 0% rage raid_movement
5:33.189 solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power | 0.0/100: 0% rage
5:34.472 solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power | 0.0/100: 0% rage
5:35.752 solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power | 0.0/100: 0% rage
5:37.034 solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power | 0.0/100: 0% rage
5:38.316 solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power | 0.0/100: 0% rage
5:39.597 solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power | 0.0/100: 0% rage
5:40.879 solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power | 0.0/100: 0% rage
5:42.163 solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power | 0.0/100: 0% rage
5:43.445 solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power | 0.0/100: 0% rage
5:44.727 solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power | 0.0/100: 0% rage
5:46.008 new_moon Fluffy_Pillow 7.5/100: 8% astral_power | 0.0/100: 0% rage
5:47.290 solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
5:48.571 Waiting 0.500 sec 17.5/100: 18% astral_power | 0.0/100: 0% rage raid_movement
5:49.071 moonfire Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage raid_movement
5:50.353 solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
5:51.636 solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
5:52.917 solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
5:54.201 stellar_flare Fluffy_Pillow 17.5/100: 18% astral_power | 0.0/100: 0% rage
5:55.484 solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage
5:56.765 solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage
5:58.047 solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage
5:59.331 solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage
6:00.616 half_moon Fluffy_Pillow 2.5/100: 3% astral_power | 0.0/100: 0% rage
6:02.325 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
6:03.609 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
6:04.892 Waiting 0.300 sec 22.5/100: 23% astral_power | 0.0/100: 0% rage raid_movement
6:05.192 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
6:06.474 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
6:07.756 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
6:09.037 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
6:10.320 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
6:11.602 moonfire Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
6:12.884 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
6:14.166 solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
6:15.447 full_moon Fluffy_Pillow 22.5/100: 23% astral_power | 0.0/100: 0% rage
6:18.007 stellar_flare Fluffy_Pillow 62.5/100: 63% astral_power | 0.0/100: 0% rage
6:19.290 celestial_alignment Fluffy_Pillow 47.5/100: 48% astral_power | 0.0/100: 0% rage
6:19.290 starsurge Fluffy_Pillow 47.5/100: 48% astral_power | 0.0/100: 0% rage celestial_alignment
6:20.573 Waiting 0.600 sec 7.5/100: 8% astral_power | 0.0/100: 0% rage raid_movement, celestial_alignment, lunar_empowerment, solar_empowerment
6:21.173 solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment, solar_empowerment
6:22.200 lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power | 0.0/100: 0% rage celestial_alignment, lunar_empowerment
6:23.908 solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage celestial_alignment
6:25.190 solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage celestial_alignment
6:26.474 solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage celestial_alignment
6:27.756 solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage celestial_alignment
6:29.038 solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage celestial_alignment
6:30.321 solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage celestial_alignment
6:31.604 solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage celestial_alignment
6:32.887 solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage celestial_alignment
6:34.169 moonfire Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage celestial_alignment
6:35.453 new_moon Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 33546 33546 20182
Intellect 33394 31688 22854 (10963)
Spirit 0 0 0
Health 2012760 2012760 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 33394 31688 0
Crit 21.92% 21.92% 5921
Haste 17.34% 16.19% 5261
Damage / Heal Versatility 2.08% 2.08% 834
Attack Power 9353 9028 0
Mastery 46.36% 46.36% 5312
Armor 7710 2056 2056
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 853.00
Local Head Purified Vision of Sargeras
ilevel: 840, stats: { 259 Armor, +1182 AgiInt, +1773 Sta, +763 Haste, +494 Crit }
Local Neck Tightweb Choker
ilevel: 840, stats: { +997 Sta, +1011 Haste, +758 Crit }
Local Shoulders Otherworldy Leather Mantle
ilevel: 850, stats: { 247 Armor, +1459 Sta, +973 AgiInt, +594 Crit, +385 Mastery }
Local Shirt Gray Woolen Shirt
ilevel: 1
Local Chest Scarred Ragefang Chestpiece
ilevel: 855, stats: { 335 Armor, +2038 Sta, +1359 AgiInt, +836 Mastery, +494 Haste }
Local Waist Dreadhide Girdle
ilevel: 835, stats: { 176 Armor, +846 AgiInt, +1269 Sta, +542 Crit, +384 Haste }
Local Legs Felbat Leather Leggings
ilevel: 855, stats: { 293 Armor, +1359 AgiInt, +2039 Sta, +807 Crit, +523 Vers }
Local Feet Mana-Tanned Sandals
ilevel: 860, stats: { 234 Armor, +1601 Sta, +1068 AgiInt, +704 Mastery, +311 Crit }
Local Wrists Oneth's Intuition
ilevel: 895, stats: { 167 Armor, +1665 Sta, +1110 AgiInt, +496 Crit, +372 Haste }
Local Hands Seaweed "Leather" Mitts
ilevel: 860, stats: { 213 Armor, +1601 Sta, +1068 AgiInt, +704 Crit, +311 Vers, +435 Avoidance }
Local Finger1 Mindrend Band
ilevel: 850, stats: { +1094 Sta, +1154 Mastery, +682 Haste }
Local Finger2 Ring of Twisted Webbing
ilevel: 840, stats: { +997 Sta, +1111 Mastery, +657 Haste }
Local Trinket1 Nightmare Bloom
ilevel: 840, stats: { +1123 Int, +898 Haste }
Local Trinket2 Twisting Wind
ilevel: 850, stats: { +1233 AgiInt }, gems: { +150 Mastery }
Local Back Cloak of Unwavering Loyalty
ilevel: 855, stats: { 132 Armor, +765 StrAgiInt, +1147 Sta, +481 Crit, +267 Mastery }
Local Main Hand Scythe of Elune
ilevel: 877, weapon: { 4315 - 6474, 3.6 }, stats: { +1668 Int, +2502 Sta, +734 Crit, +705 Mastery, +9100 Int }, relics: { +40 ilevels, +42 ilevels, +45 ilevels }
Local Tabard Orgrimmar Tabard
ilevel: 600

Talents

Level
15 Force of Nature (Balance Druid) Warrior of Elune (Balance Druid) Starlord (Balance Druid)
30 Renewal Displacer Beast Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Incarnation: Chosen of Elune Stellar Flare (Balance Druid)
90 Shooting Stars (Balance Druid) Astral Communion (Balance Druid) Blessing of the Ancients (Balance Druid)
100 Fury of Elune (Balance Druid) Stellar Drift (Balance Druid) Nature's Balance (Balance Druid)

Profile

druid="Buuey"
origin="https://us.api.battle.net/wow/character/thrall/Buuey/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/220/133788636-avatar.jpg"
level=110
race=tauren
role=spell
position=back
professions=jewelcrafting=720/leatherworking=752
talents=3223333
artifact=59:0:0:0:0:1034:3:1035:3:1036:2:1038:3:1039:3:1040:3:1044:1:1045:1:1047:1:1048:1:1049:1:1294:1
spec=balance

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/moonkin_form
actions.precombat+=/blessing_of_elune
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/new_moon

# Executed every time the actor is available.
actions=potion,name=deadly_grace,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/blessing_of_elune,if=active_enemies<=2&talent.blessing_of_the_ancients.enabled&buff.blessing_of_elune.down
actions+=/blessing_of_elune,if=active_enemies>=3&talent.blessing_of_the_ancients.enabled&buff.blessing_of_anshe.down
actions+=/blood_fury,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/berserking,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/arcane_torrent,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/call_action_list,name=fury_of_elune,if=talent.fury_of_elune.enabled&cooldown.fury_of_elue.remains<target.time_to_die
actions+=/call_action_list,name=ed,if=equipped.the_emerald_dreamcatcher
actions+=/new_moon,if=(charges=2&recharge_time<5)|charges=3
actions+=/half_moon,if=(charges=2&recharge_time<5)|charges=3|(target.time_to_die<15&charges=2)
actions+=/full_moon,if=(charges=2&recharge_time<5)|charges=3|target.time_to_die<15
actions+=/stellar_flare,cycle_targets=1,max_cycle_targets=4,if=active_enemies<4&remains<7.2&astral_power>=15
actions+=/moonfire,if=(talent.natures_balance.enabled&remains<3)|(remains<6.6&!talent.natures_balance.enabled)
actions+=/sunfire,if=(talent.natures_balance.enabled&remains<3)|(remains<5.4&!talent.natures_balance.enabled)
actions+=/astral_communion,if=astral_power.deficit>=75
actions+=/incarnation,if=astral_power>=40
actions+=/celestial_alignment,if=astral_power>=40
actions+=/starfall,if=buff.oneths_overconfidence.up
actions+=/solar_wrath,if=buff.solar_empowerment.stack=3
actions+=/lunar_strike,if=buff.lunar_empowerment.stack=3
actions+=/call_action_list,name=celestial_alignment_phase,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/call_action_list,name=single_target

actions.celestial_alignment_phase=starfall,if=(active_enemies>=2&talent.stellar_flare.enabled|active_enemies>=3)&((talent.fury_of_elune.enabled&cooldown.fury_of_elune.remains>12&buff.fury_of_elune_up.down)|!talent.fury_of_elune.enabled)
actions.celestial_alignment_phase+=/starsurge,if=active_enemies<=2
actions.celestial_alignment_phase+=/warrior_of_elune
actions.celestial_alignment_phase+=/lunar_strike,if=buff.warrior_of_elune.up
actions.celestial_alignment_phase+=/solar_wrath,if=buff.solar_empowerment.up
actions.celestial_alignment_phase+=/lunar_strike,if=buff.lunar_empowerment.up
actions.celestial_alignment_phase+=/solar_wrath,if=talent.natures_balance.enabled&dot.sunfire_dmg.remains<5&cast_time<dot.sunfire_dmg.remains
actions.celestial_alignment_phase+=/lunar_strike,if=(talent.natures_balance.enabled&dot.moonfire_dmg.remains<5&cast_time<dot.moonfire_dmg.remains)|active_enemies>=2
actions.celestial_alignment_phase+=/solar_wrath

actions.ed=astral_communion,if=astral_power.deficit>=75&buff.the_emerald_dreamcatcher.up
actions.ed+=/incarnation,if=astral_power>=85&!buff.the_emerald_dreamcatcher.up
actions.ed+=/celestial_alignment,if=astral_power>=85&!buff.the_emerald_dreamcatcher.up
actions.ed+=/starsurge,if=(buff.the_emerald_dreamcatcher.up&buff.the_emerald_dreamcatcher.remains<gcd.max)|astral_power>=90|((buff.celestial_alignment.up|buff.incarnation.up)&astral_power>=85)
actions.ed+=/stellar_flare,cycle_targets=1,max_cycle_targets=4,if=active_enemies<4&remains<7.2&astral_power>=15
actions.ed+=/moonfire,if=(talent.natures_balance.enabled&remains<3)|(remains<6.6&!talent.natures_balance.enabled)
actions.ed+=/sunfire,if=(talent.natures_balance.enabled&remains<3)|(remains<5.4&!talent.natures_balance.enabled)
actions.ed+=/solar_wrath,if=buff.solar_empowerment.up&buff.the_emerald_dreamcatcher.remains>execute_time&astral_power>=12&dot.sunfire.remains<5.4&dot.moonfire.remains>6.6
actions.ed+=/lunar_strike,if=buff.lunar_empowerment.up&buff.the_emerald_dreamcatcher.remains>execute_time&astral_power>=8&(!(buff.celestial_alignment.up|buff.incarnation.up)|(buff.celestial_alignment.up|buff.incarnation.up)&astral_power<=77)
actions.ed+=/new_moon,if=astral_power<=90
actions.ed+=/half_moon,if=astral_power<=80
actions.ed+=/full_moon,if=astral_power<=60
actions.ed+=/solar_wrath,if=buff.solar_empowerment.up
actions.ed+=/lunar_strike,if=buff.lunar_empowerment.up
actions.ed+=/solar_wrath

actions.fury_of_elune=incarnation,if=astral_power>=95&cooldown.fury_of_elune.remains<=gcd
actions.fury_of_elune+=/fury_of_elune,if=astral_power>=95
actions.fury_of_elune+=/new_moon,if=((charges=2&recharge_time<5)|charges=3)&&(buff.fury_of_elune_up.up|(cooldown.fury_of_elune.remains>gcd*3&astral_power<=90))
actions.fury_of_elune+=/half_moon,if=((charges=2&recharge_time<5)|charges=3)&&(buff.fury_of_elune_up.up|(cooldown.fury_of_elune.remains>gcd*3&astral_power<=80))
actions.fury_of_elune+=/full_moon,if=((charges=2&recharge_time<5)|charges=3)&&(buff.fury_of_elune_up.up|(cooldown.fury_of_elune.remains>gcd*3&astral_power<=60))
actions.fury_of_elune+=/astral_communion,if=buff.fury_of_elune_up.up&astral_power<=25
actions.fury_of_elune+=/warrior_of_elune,if=buff.fury_of_elune_up.up|(cooldown.fury_of_elune.remains>=35&buff.lunar_empowerment.up)
actions.fury_of_elune+=/lunar_strike,if=buff.warrior_of_elune.up&(astral_power<=90|(astral_power<=85&buff.incarnation.up))
actions.fury_of_elune+=/new_moon,if=astral_power<=90&buff.fury_of_elune_up.up
actions.fury_of_elune+=/half_moon,if=astral_power<=80&buff.fury_of_elune_up.up&astral_power>cast_time*12
actions.fury_of_elune+=/full_moon,if=astral_power<=60&buff.fury_of_elune_up.up&astral_power>cast_time*12
actions.fury_of_elune+=/moonfire,if=buff.fury_of_elune_up.down&remains<=6.6
actions.fury_of_elune+=/sunfire,if=buff.fury_of_elune_up.down&remains<5.4
actions.fury_of_elune+=/stellar_flare,if=remains<7.2&active_enemies=1
actions.fury_of_elune+=/starfall,if=(active_enemies>=2&talent.stellar_flare.enabled|active_enemies>=3)&buff.fury_of_elune_up.down&cooldown.fury_of_elune.remains>10
actions.fury_of_elune+=/starsurge,if=active_enemies<=2&buff.fury_of_elune_up.down&cooldown.fury_of_elune.remains>7
actions.fury_of_elune+=/starsurge,if=buff.fury_of_elune_up.down&((astral_power>=92&cooldown.fury_of_elune.remains>gcd*3)|(cooldown.warrior_of_elune.remains<=5&cooldown.fury_of_elune.remains>=35&buff.lunar_empowerment.stack<2))
actions.fury_of_elune+=/solar_wrath,if=buff.solar_empowerment.up
actions.fury_of_elune+=/lunar_strike,if=buff.lunar_empowerment.stack=3|(buff.lunar_empowerment.remains<5&buff.lunar_empowerment.up)|active_enemies>=2
actions.fury_of_elune+=/solar_wrath

actions.single_target=new_moon,if=astral_power<=90
actions.single_target+=/half_moon,if=astral_power<=80
actions.single_target+=/full_moon,if=astral_power<=60
actions.single_target+=/starfall,if=(active_enemies>=2&talent.stellar_flare.enabled|active_enemies>=3)&((talent.fury_of_elune.enabled&cooldown.fury_of_elune.remains>12&buff.fury_of_elune_up.down)|!talent.fury_of_elune.enabled)
actions.single_target+=/starsurge,if=active_enemies<=2
actions.single_target+=/warrior_of_elune
actions.single_target+=/lunar_strike,if=buff.warrior_of_elune.up
actions.single_target+=/solar_wrath,if=buff.solar_empowerment.up
actions.single_target+=/lunar_strike,if=buff.lunar_empowerment.up
actions.single_target+=/solar_wrath,if=talent.natures_balance.enabled&dot.sunfire_dmg.remains<5&cast_time<dot.sunfire_dmg.remains
actions.single_target+=/lunar_strike,if=(talent.natures_balance.enabled&dot.moonfire_dmg.remains<5&cast_time<dot.moonfire_dmg.remains)|active_enemies>=2
actions.single_target+=/solar_wrath

head=purified_vision_of_sargeras,id=139946
neck=tightweb_choker,id=134541,bonus_id=1727/1492/1813
shoulders=otherworldy_leather_mantle,id=139206,bonus_id=1807/1472
back=cloak_of_unwavering_loyalty,id=134412,bonus_id=1727/1507/3337
chest=scarred_ragefang_chestpiece,id=139208,bonus_id=1807/1477/3336
shirt=gray_woolen_shirt,id=2587
tabard=orgrimmar_tabard,id=118372
wrists=oneths_intuition,id=137092,bonus_id=1811
hands=seaweed_leather_mitts,id=141440,bonus_id=40/1472
waist=dreadhide_girdle,id=121299,bonus_id=3432/1497/1674
legs=felbat_leather_leggings,id=134370,bonus_id=1727/1517/3337
feet=manatanned_sandals,id=141430,bonus_id=1472
finger1=mindrend_band,id=138220,bonus_id=1807/1472
finger2=ring_of_twisted_webbing,id=134540,bonus_id=1727/1492/1813
trinket1=nightmare_bloom,id=121311,bonus_id=3432/604/1502/3336
trinket2=twisting_wind,id=139323,bonus_id=1807/1808/1472,gems=150mastery
main_hand=scythe_of_elune,id=128858,bonus_id=722,gem_id=137420/141275/139269/0,relic_id=1727:1492:1813/3397:1507:3337/1807:1477:3336/0

# Gear Summary
# gear_ilvl=853.47
# gear_stamina=20182
# gear_intellect=22854
# gear_crit_rating=5921
# gear_haste_rating=5261
# gear_mastery_rating=5312
# gear_versatility_rating=834
# gear_avoidance_rating=435
# gear_armor=2056

Oinkie

Oinkie : 266819 dps, 171977 dps to main target

  • Race: Tauren
  • Class: Druid
  • Spec: Feral
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
266819.2 266819.2 174.6 / 0.065% 34665.0 / 13.0% 17919.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
14.9 14.9 Energy 20.14% 43.9 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Oinkie/advanced
Talents
  • 15: Lunar Inspiration (Feral Druid)
  • 30: Wild Charge
  • 45: Balance Affinity
  • 60: Mighty Bash
  • 75: Incarnation: King of the Jungle (Feral Druid)
  • 90: Jagged Wounds (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Artifact
Professions
  • herbalism: 815
  • inscription: 713
Scale Factors for Oinkie Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 9.27 6.41 6.00 5.21 3.97
Normalized 1.00 0.69 0.65 0.56 0.43
Scale Deltas 1138 1138 1138 1138 1138
Error 0.22 0.22 0.22 0.22 0.22
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Haste > Mastery
Pawn string ( Pawn: v1: "Oinkie": Agility=9.27, CritRating=6.00, HasteRating=5.21, MasteryRating=3.97, Versatility=6.41 )

Scale Factors for other metrics

Scale Factors for Oinkie Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 9.27 6.41 6.00 5.21 3.97
Normalized 1.00 0.69 0.65 0.56 0.43
Scale Deltas 1138 1138 1138 1138 1138
Error 0.22 0.22 0.22 0.22 0.22
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Haste > Mastery
Pawn string ( Pawn: v1: "Oinkie": Agility=9.27, CritRating=6.00, HasteRating=5.21, MasteryRating=3.97, Versatility=6.41 )
Scale Factors for Oinkie Priority Target Damage Per Second
Agi Vers Haste Crit Mastery
Scale Factors 6.03 4.08 3.77 3.69 2.75
Normalized 1.00 0.68 0.63 0.61 0.46
Scale Deltas 1138 1138 1138 1138 1138
Error 0.23 0.23 0.23 0.23 0.23
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Haste ~= Crit > Mastery
Pawn string ( Pawn: v1: "Oinkie": Agility=6.03, CritRating=3.69, HasteRating=3.77, MasteryRating=2.75, Versatility=4.08 )
Scale Factors for Oinkie Damage Per Second (Effective)
Agi Vers Crit Haste Mastery
Scale Factors 9.27 6.41 6.00 5.21 3.97
Normalized 1.00 0.69 0.65 0.56 0.43
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Haste > Mastery
Pawn string ( Pawn: v1: "Oinkie": Agility=9.27, CritRating=6.00, HasteRating=5.21, MasteryRating=3.97, Versatility=6.41 )
Scale Factors for Oinkie Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Oinkie Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Oinkie Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Oinkie Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Oinkie Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Oinkie Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Oinkie Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for OinkieTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Oinkie 266819
Ashamane's Rip 10071 3.9% 7.7 48.58sec 534986 0 Periodic 67.4 46016 93892 61295 31.9% 21.7%

Stats details: ashamanes_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.72 0.00 67.37 67.37 0.0000 1.2916 4129595.07 4129595.07 0.00 47456.79 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.9 68.09% 46015.80 32 54021 45803.49 0 54021 2110872 2110872 0.00
crit 21.5 31.91% 93891.99 65 110202 93403.26 0 110202 2018723 2018723 0.00
 
 

Action details: ashamanes_rip

Static Values
  • id:210705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210705
  • name:Ashamane's Rip
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc210702=Your combo point generators against targets bleeding from your Rip have a {$h=10}% chance to awaken the Spirit of Ashamane, which inflicts a Shadowy duplicate of that Rip on the target.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cat_melee 25182 9.5% 432.3 0.93sec 23360 28264 Direct 432.3 17549 35797 23360 31.8%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 432.31 432.31 0.00 0.00 0.8265 0.0000 10098918.10 14291360.15 29.34 28264.22 28264.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 294.63 68.15% 17548.57 16006 21268 17550.47 17227 17833 5170314 7316741 29.33
crit 137.68 31.85% 35796.82 32653 43387 35800.88 34930 36757 4928605 6974619 29.33
 
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ferocious Bite 7106 2.7% 14.7 28.44sec 198305 197422 Direct 14.7 141290 319016 198303 32.1%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.65 14.65 0.00 0.00 1.0045 0.0000 2905854.89 4106830.56 29.24 197422.03 197422.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.95 67.92% 141290.35 13672 179762 139313.11 0 179762 1406204 1987487 29.20
crit 4.70 32.08% 319016.15 31503 405975 312255.87 0 405975 1499651 2119344 28.99
 
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes Physical damage per combo point and consumes up to 25 additional Energy to increase damage by up to 100%. {$?s202031=false}[]?s231056[When used on targets below 25% health, ][]{$?s231056=true}[Ferocious Bite will also refresh the duration of your Rip on your target. ][] 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.745000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Moonfire (lunar_inspiration) 13355 5.1% 17.5 23.61sec 308869 307502 Direct 17.5 32440 66196 43106 31.6%  
Periodic 147.6 23656 48290 31497 31.8% 59.5%

Stats details: lunar_inspiration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.50 17.50 147.62 147.62 1.0045 1.6155 5403734.15 5403734.15 0.00 21103.80 307502.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.97 68.40% 32439.71 29874 37790 32477.98 29874 35500 388205 388205 0.00
crit 5.53 31.60% 66195.74 60942 77092 66159.19 0 77092 365945 365945 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 100.6 68.17% 23656.48 250 29393 23632.94 22141 25078 2380648 2380648 0.00
crit 47.0 31.83% 48289.68 511 59961 48238.83 43780 51545 2268937 2268937 0.00
 
 

Action details: lunar_inspiration

Static Values
  • id:155625
  • school:arcane
  • resource:energy
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
Spelldata
  • id:155625
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:A quick beam of lunar light burns the enemy for {$s2=1} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.875000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 11111 4.1% 24.3 13.99sec 180897 0 Direct 24.3 136119 277578 180894 31.7%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.30 24.30 0.00 0.00 0.0000 0.0000 4395559.63 6461889.02 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.61 68.35% 136118.74 122155 154527 136100.96 125128 148480 2260576 3323261 31.98
crit 7.69 31.65% 277578.15 249197 315234 277496.61 0 315234 2134984 3138628 31.97
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rake 24566 9.3% 19.1 22.40sec 521953 519630 Direct 19.1 66921 136272 89025 31.9%  
Periodic 111.2 55832 113870 74348 31.9% 46.6%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.10 19.10 111.22 111.22 1.0045 1.6800 9969615.54 9969615.54 0.00 48386.56 519629.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.01 68.13% 66920.70 48685 123172 66965.51 48685 87925 870797 870797 0.00
crit 6.09 31.87% 136272.03 99317 251271 136040.46 0 251271 829619 829619 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.7 68.10% 55831.84 97 123172 55856.12 44299 66863 4228600 4228600 0.00
crit 35.5 31.90% 113869.66 198 251271 113906.68 72255 162695 4040600 4040600 0.00
 
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}.{$?s48484=false}[ Reduces the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][]$?a231052[ While stealthed, Rake will also stun the target for {$163505d=4 seconds}, and deal {$s4=100}% increased damage.][] |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.912000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rip 46281 17.4% 23.4 14.28sec 791202 787678 Periodic 311.8 44640 91062 59470 31.9% 101.7%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.44 0.00 311.82 311.82 1.0045 1.3077 18544310.23 18544310.23 0.00 42993.52 787678.30
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 212.2 68.05% 44640.23 32 54021 44606.84 42099 46919 9473033 9473033 0.00
crit 99.6 31.95% 91061.95 65 110202 90993.76 83236 96833 9071277 9071277 0.00
 
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>*12)} damage 2 points: ${$floor(2*$<rip>*12)} damage 3 points: ${$floor(3*$<rip>*12)} damage 4 points: ${$floor(4*$<rip>*12)} damage 5 points: ${$floor(5*$<rip>*12)} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.08
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shred 23034 8.8% 51.5 7.83sec 181899 181086 Direct 51.5 74771 215984 181903 75.9%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.52 51.52 0.00 0.00 1.0045 0.0000 9371948.31 13224597.77 29.13 181086.45 181086.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.44 24.14% 74771.19 58150 84290 74497.72 61080 84290 929860 1317223 29.38
crit 39.09 75.86% 215983.72 118626 283720 216522.41 193943 245002 8442088 11907374 29.10
 
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.20
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing ${$sw1*$<mult>} Physical damage to the target.$?a231063[ Deals {$s5=20}% increased damage against bleeding targets.][]$?a231057[ While stealthed, Shred deals $m4% increased damage, and has double the chance to critically strike.][] |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.95
 
Swipe (_cat) 72831 27.0% 71.6 4.07sec 401963 400164 Direct 429.8 50312 102642 66994 31.9%  

Stats details: swipe_cat

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 71.63 429.76 0.00 0.00 1.0045 0.0000 28791365.11 41892595.09 31.27 400163.52 400163.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 292.76 68.12% 50312.26 38924 62064 50290.02 47234 52649 14729670 21432261 31.27
crit 137.00 31.88% 102642.33 79406 126611 102598.16 96157 107586 14061695 20460335 31.27
 
 

Action details: swipe_cat

Static Values
  • id:106785
  • school:physical
  • resource:energy
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:45.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.swipe_cat>=8
Spelldata
  • id:106785
  • name:Swipe
  • school:physical
  • tooltip:
  • description:Swipe nearby enemies, inflicting $sw3 Physical damage.$?a231283[ Deals {$s2=20}% increased damage against bleeding targets.][] |cFFFFFFFFAwards {$s1=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:5.00
 
Thrash (_cat) 33282 12.3% 24.5 12.11sec 536530 534138 Direct 147.1 18714 38183 24929 31.9%  
Periodic 566.6 12571 25642 16740 31.9% 271.6%

Stats details: thrash_cat

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.51 147.06 566.57 566.57 1.0045 1.9225 13150486.06 13150486.06 0.00 11806.40 534138.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 100.11 68.08% 18714.02 18089 22883 18707.98 18089 19380 1873499 1873499 0.00
crit 46.95 31.92% 38182.74 36902 46681 38169.35 36902 40151 1792649 1792649 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 385.9 68.11% 12571.39 7 16298 12572.47 11765 13581 4851029 4851029 0.00
crit 180.7 31.89% 25641.71 13 33247 25644.62 23206 27747 4633309 4633309 0.00
 
 

Action details: thrash_cat

Static Values
  • id:106830
  • school:physical
  • resource:energy
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=duration*0.3&spell_targets.thrash_cat>=5
Spelldata
  • id:106830
  • name:Thrash
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2 sec.
  • description:Strikes all nearby enemies, dealing $m1 Bleed damage and an additional $o2 Bleed damage over {$d=15 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.410000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.292000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:10.05
  • base_tick_time:2.01
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Oinkie
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Oinkie
  • harmful:false
  • if_expr:
 
Cat Form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
 
Dash 2.4 188.76sec

Stats details: dash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.36 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dash

Static Values
  • id:1850
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.cat_form.up
Spelldata
  • id:1850
  • name:Dash
  • school:physical
  • tooltip:Increased movement speed by {$s1=70}% while in Cat Form.
  • description:Activates Cat Form and increases movement speed by {$s1=70}% while in Cat Form for {$d=15 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Oinkie
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Oinkie
  • harmful:false
  • if_expr:
 
Incarnation: King of the Jungle (incarnation) 2.7 181.08sec

Stats details: incarnation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.74 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: incarnation

Static Values
  • id:102543
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.tigers_fury.remains<gcd
Spelldata
  • id:102543
  • name:Incarnation: King of the Jungle
  • school:physical
  • tooltip:Incarnation: King of the Jungle activated.
  • description:An improved Cat Form that allows the use of Prowl while in combat, causes Shred and Rake to deal damage as if stealth were active, reduces the cost of all Cat Form abilities by {$s2=50}%, and increases maximum Energy by {$s3=50}. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Cat Form for its duration.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Tiger's Fury 13.6 30.52sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.60 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=20} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
 
Wild Charge 16.2 24.23sec

Stats details: wild_charge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.19 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: wild_charge

Static Values
  • id:102401
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:102401
  • name:Wild Charge
  • school:physical
  • tooltip:Flying to an ally's position.
  • description:Fly to a nearby ally's position.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Acceleration 6.4 1.1 57.8sec 47.9sec 17.14% 17.14% 1.1(1.1) 6.2

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_acceleration
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:5927.22

Stack Uptimes

  • acceleration_1:17.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:214128
  • name:Acceleration
  • tooltip:Haste increased by $w1. Movement speed increased by $w2%.
  • description:{$@spelldesc214120=Your spells and abilities have a chance to grant you {$214128s1=4657} Haste and {$214128s2=15}% movement speed for {$214128d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Ashamane's Energy 13.6 0.0 30.5sec 30.5sec 10.14% 10.14% 40.6(40.6) 13.5

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_ashamanes_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:20.00

Stack Uptimes

  • ashamanes_energy_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210583
  • name:Ashamane's Energy
  • tooltip:Gaining $w1 energy every $t sec.
  • description:{$@spelldesc210579=Tiger's Fury generates an additional {$s1=5} energy every $210583t sec for {$210583d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.12% 9.36% 0.0(0.0) 1.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 36.9 0.9 10.7sec 10.4sec 4.98% 16.49% 0.9(0.9) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_clearcasting
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • clearcasting_1:4.98%

Trigger Attempt Success

  • trigger_pct:8.75%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Cat Form abilities have {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your auto attacks have a chance to cause a Clearcasting state, making your next Cat Form ability cost no Energy.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Dash 2.4 0.0 188.7sec 188.7sec 8.67% 11.27% 0.0(0.0) 2.3

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_dash
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.70

Stack Uptimes

  • dash_1:8.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1850
  • name:Dash
  • tooltip:Increased movement speed by {$s1=70}% while in Cat Form.
  • description:Activates Cat Form and increases movement speed by {$s1=70}% while in Cat Form for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Feral Instinct 2.7 0.0 181.1sec 181.1sec 10.03% 13.56% 0.0(0.0) 2.6

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_feral_instinct
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • feral_instinct_1:10.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210649
  • name:Feral Instinct
  • tooltip:Damage dealt increased by $w1%.
  • description:{$@spelldesc210631={$?s102543=false}[Incarnation: King of the Jungle][Berserk] increases all damage you deal by {$s1=5}% for {$210649d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Incarnation: King of the Jungle 2.7 0.0 181.1sec 181.1sec 19.67% 41.82% 0.0(0.0) 2.5

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_incarnation_king_of_the_jungle
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.50

Stack Uptimes

  • incarnation_king_of_the_jungle_1:19.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:102543
  • name:Incarnation: King of the Jungle
  • tooltip:Incarnation: King of the Jungle activated.
  • description:An improved Cat Form that allows the use of Prowl while in combat, causes Shred and Rake to deal damage as if stealth were active, reduces the cost of all Cat Form abilities by {$s2=50}%, and increases maximum Energy by {$s3=50}. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Cat Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Potion of the Old War 2.0 0.0 290.5sec 0.0sec 12.15% 12.15% 0.0(0.0) 2.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Predatory Swiftness 15.8 21.5 25.1sec 10.8sec 83.46% 83.46% 21.5(21.5) 14.9

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • predatory_swiftness_1:83.46%

Trigger Attempt Success

  • trigger_pct:97.83%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Regrowth, or Rebirth will be instant, free, and castable in all forms.
  • description:{$@spelldesc16974=Your finishing moves have a {$s3=20}% chance per combo point to make your next Regrowth, Entangling Roots, or Rebirth instant, free, and castable in all forms.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Protection of Ashamane 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_protection_of_ashamane
  • max_stacks:1
  • duration:5.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210655
  • name:Protection of Ashamane
  • tooltip:Chance to dodge attacks increased by $w1%. Armor increased by {$s2=100}%.
  • description:{$@spelldesc210650=When you shapeshift out of Cat Form, you gain {$210655s1=100}% increased dodge chance and armor for {$210655d=5 seconds} or until you shapeshift back into Cat Form. Can only occur once every {$214274d=30 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Prowl 1.0 0.0 0.0sec 0.0sec 0.00% 1.52% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.
  • description:Activates Cat Form and places you into stealth until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
raid_movement 33.8 1.0 11.6sec 11.3sec 6.60% 6.60% 1.0(1.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:6.60%

Trigger Attempt Success

  • trigger_pct:100.00%
Scent of Blood 24.5 0.0 12.1sec 12.1sec 24.81% 49.94% 0.0(0.0) 24.5

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_scent_of_blood
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-2.00

Stack Uptimes

  • scent_of_blood_1:24.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210664
  • name:Scent of Blood
  • tooltip:Energy cost of {$?s202028=false}[Brutal Slash][Swipe] reduced by $w1.
  • description:{$@spelldesc210663=Each target hit by Thrash reduces the cost of {$?s202028=false}[Brutal Slash][Swipe] by {$s1=2} Energy for the next {$210664d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Tiger's Fury 13.6 0.0 30.5sec 30.5sec 26.88% 31.09% 0.0(0.0) 13.3

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=20} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
wild_charge_movement 16.2 0.0 24.3sec 24.3sec 0.98% 14.37% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_wild_charge_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • wild_charge_movement_1:0.98%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
Cat Form

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • cat_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Defiled Augmentation

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (nightborne_delicacy_platter)

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Oinkie
ferocious_bite Energy 29.3 451.5 15.4 30.8 6436.6
ferocious_bite Combo Points 14.7 69.5 4.7 4.7 41821.7
lunar_inspiration Energy 17.5 392.9 22.5 22.5 13754.4
rake Energy 19.1 527.9 27.6 27.6 18886.0
rip Energy 23.4 489.0 20.9 20.9 37926.3
rip Combo Points 23.4 117.2 5.0 5.0 158241.6
shred Energy 51.5 1267.1 24.6 24.6 7396.1
swipe_cat Energy 71.6 1932.8 27.0 27.0 14896.3
thrash_cat Energy 24.5 896.8 36.6 36.6 14663.4
Resource Gains Type Count Total Average Overflow
rake Combo Points 19.10 19.04 (10.02%) 1.00 0.06 0.33%
tigers_fury Energy 13.60 272.02 (3.78%) 20.00 0.00 0.00%
swipe_cat Combo Points 71.63 0.70 (0.37%) 0.01 0.01 1.84%
lunar_inspiration Combo Points 17.50 17.44 (9.18%) 1.00 0.06 0.31%
shred Combo Points 51.52 51.46 (27.09%) 1.00 0.06 0.12%
energy_regen Energy 1581.07 4816.42 (66.99%) 3.05 21.26 0.44%
clearcasting Energy 36.77 1296.00 (18.03%) 35.25 0.00 0.00%
ashamanes_energy Energy 40.60 804.83 (11.19%) 19.82 7.24 0.89%
primal_fury Combo Points 115.19 101.35 (53.34%) 0.88 13.85 12.02%
Resource RPS-Gain RPS-Loss
Energy 14.70 14.86
Combo Points 0.47 0.47
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 33.58 0.00 100.00
Astral Power 0.00 0.00 0.00
Combo Points 3.28 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.2%

Procs

Count Interval
clearcasting 37.8 10.4sec
clearcasting_wasted 0.9 105.1sec
primal_fury 115.2 3.5sec

Statistics & Data Analysis

Fight Length
Sample Data Oinkie Fight Length
Count 9999
Mean 401.00
Minimum 308.02
Maximum 501.87
Spread ( max - min ) 193.85
Range [ ( max - min ) / 2 * 100% ] 24.17%
DPS
Sample Data Oinkie Damage Per Second
Count 9999
Mean 266819.17
Minimum 235506.86
Maximum 302987.18
Spread ( max - min ) 67480.32
Range [ ( max - min ) / 2 * 100% ] 12.65%
Standard Deviation 8907.4739
5th Percentile 252387.54
95th Percentile 281719.69
( 95th Percentile - 5th Percentile ) 29332.14
Mean Distribution
Standard Deviation 89.0792
95.00% Confidence Intervall ( 266644.58 - 266993.77 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4281
0.1 Scale Factor Error with Delta=300 677318
0.05 Scale Factor Error with Delta=300 2709273
0.01 Scale Factor Error with Delta=300 67731826
Priority Target DPS
Sample Data Oinkie Priority Target Damage Per Second
Count 9999
Mean 171976.73
Minimum 140204.92
Maximum 199509.86
Spread ( max - min ) 59304.94
Range [ ( max - min ) / 2 * 100% ] 17.24%
Standard Deviation 9150.0347
5th Percentile 155743.40
95th Percentile 185078.17
( 95th Percentile - 5th Percentile ) 29334.77
Mean Distribution
Standard Deviation 91.5049
95.00% Confidence Intervall ( 171797.38 - 172156.07 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 108
0.1% Error 10874
0.1 Scale Factor Error with Delta=300 714708
0.05 Scale Factor Error with Delta=300 2858835
0.01 Scale Factor Error with Delta=300 71470883
DPS(e)
Sample Data Oinkie Damage Per Second (Effective)
Count 9999
Mean 266819.17
Minimum 235506.86
Maximum 302987.18
Spread ( max - min ) 67480.32
Range [ ( max - min ) / 2 * 100% ] 12.65%
Damage
Sample Data Oinkie Damage
Count 9999
Mean 106761387.10
Minimum 81356809.48
Maximum 132770922.69
Spread ( max - min ) 51414113.21
Range [ ( max - min ) / 2 * 100% ] 24.08%
DTPS
Sample Data Oinkie Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Oinkie Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Oinkie Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Oinkie Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Oinkie Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Oinkie Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data OinkieTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Oinkie Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 cat_form
4 0.00 prowl
5 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
6 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
0.00 dash,if=!buff.cat_form.up
0.00 cat_form
7 16.18 wild_charge
0.00 displacer_beast,if=movement.distance>10
8 2.36 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
9 1.00 rake,if=buff.prowl.up
A 34.77 auto_attack
0.00 skull_bash
0.00 berserk,if=buff.tigers_fury.up
0.00 incarnation,if=cooldown.tigers_fury.remains<gcd
B 1.00 potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
C 13.66 tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
D 2.74 incarnation,if=energy.time_to_max>1&energy>=35
E 2.79 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Keep Rip from falling off during execute range.
F 0.00 call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
G 0.00 call_action_list,name=finisher
H 0.00 call_action_list,name=generator
actions.finisher
# count action,conditions
0.00 pool_resource,for_next=1
Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
0.00 savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
0.00 pool_resource,for_next=1
Thrash has higher priority than finishers at 5 targets
I 24.51 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
0.00 pool_resource,for_next=1
Replace Rip with Swipe at 8 targets
0.00 swipe_cat,if=spell_targets.swipe_cat>=8
J 23.44 rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Rip at 8 seconds or for a stronger Rip
0.00 savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Savage Roar early with Jagged Wounds
K 0.89 swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
L 11.86 ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.generator
# count action,conditions
0.00 brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
Brutal Slash if there's adds up
0.00 ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
0.00 pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
Pool energy for Elune's Guidance when it's coming off cooldown.
0.00 elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
0.00 pool_resource,for_next=1
Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
0.00 thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
0.00 pool_resource,for_next=1
Use Swipe over Rake or Moonfire at 6 targets.
M 70.73 swipe_cat,if=spell_targets.swipe_cat>=6
0.00 pool_resource,for_next=1
Refresh Rake early with Bloodtalons
N 18.10 rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
O 17.50 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
0.00 pool_resource,for_next=1
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
0.00 brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
Brutal Slash if you would cap out charges before the next adds spawn
0.00 swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
P 51.52 shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

Sample Sequence

0123469ADCOPPJPPPLPPN7AJOPPLPPP8IKAJMMMMMIAJMMMMCMEIMNOAPP7AIMJAICMMMMNJO7APIAMMMJMI7AMCMMMNJOP7AIAMMMJIMM7ACMMMJINOP7AIMMMJIMCM7AMMMJNOP7AIAMJMMDIMMCMJM7MAMNOLPPPJPPP8IKAJMMAMMIMMMJCMEIMMANO7IAJMMAIMCEMI7OANPJAIM7AMICMMMMJN7AOPAIMJMAICMMMMJNOAPPNJOAPCNPJPOPN7ALPPONDBLP7APPCLNOPLPPPLPPPL7ANOPLPPPLPNP

Sample Sequence Table

time name target resources buffs
Pre flask Oinkie 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points
Pre food Oinkie 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points
Pre augmentation Oinkie 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points
Pre cat_form Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points
Pre prowl Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points potion_of_the_old_war
0:00.000 rake Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points potion_of_the_old_war
0:01.004 incarnation Fluffy_Pillow 76.8/100: 77% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points bloodlust, potion_of_the_old_war
0:01.004 tigers_fury Fluffy_Pillow 76.8/150: 51% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, potion_of_the_old_war
0:01.004 lunar_inspiration Fluffy_Pillow 96.8/150: 65% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, ashamanes_energy, tigers_fury, potion_of_the_old_war
0:02.009 shred Fluffy_Pillow 116.6/150: 78% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, ashamanes_energy, tigers_fury, potion_of_the_old_war
0:03.012 shred Fluffy_Pillow 131.4/150: 88% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, ashamanes_energy, tigers_fury, potion_of_the_old_war
0:04.016 rip Fluffy_Pillow 146.2/150: 97% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, tigers_fury, potion_of_the_old_war
0:05.020 shred Fluffy_Pillow 146.0/150: 97% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury, potion_of_the_old_war
0:06.025 shred Fluffy_Pillow 140.8/150: 94% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury, potion_of_the_old_war
0:07.030 shred Fluffy_Pillow 135.7/150: 90% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury, potion_of_the_old_war
0:08.033 ferocious_bite Fluffy_Pillow 130.5/150: 87% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury, potion_of_the_old_war
0:09.039 shred Fluffy_Pillow 120.3/150: 80% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
0:10.045 shred Fluffy_Pillow 115.1/150: 77% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
0:11.049 rake Fluffy_Pillow 109.9/150: 73% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points bloodlust, clearcasting, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
0:12.052 wild_charge Fluffy_Pillow 124.7/150: 83% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, raid_movement, clearcasting, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
0:12.052 Waiting 0.200 sec 124.7/150: 83% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, raid_movement, clearcasting, wild_charge_movement, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
0:12.252 auto_attack Fluffy_Pillow 127.7/150: 85% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, clearcasting, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
0:12.252 rip Fluffy_Pillow 127.7/150: 85% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, clearcasting, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
0:13.256 lunar_inspiration Fluffy_Pillow 142.5/150: 95% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
0:14.259 shred Fluffy_Pillow 142.3/150: 95% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
0:15.263 shred Fluffy_Pillow 137.1/150: 91% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points bloodlust, clearcasting, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
0:16.265 ferocious_bite Fluffy_Pillow 150.0/150: 100% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
0:17.269 shred Fluffy_Pillow 139.8/150: 93% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, clearcasting, incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
0:18.274 shred Fluffy_Pillow 150.0/150: 100% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
0:19.279 shred Fluffy_Pillow 144.8/150: 97% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points bloodlust, incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
0:20.282 dash Fluffy_Pillow 139.6/150: 93% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, raid_movement, incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
0:20.282 thrash_cat Fluffy_Pillow 139.6/150: 93% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, raid_movement, dash, incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
0:21.287 swipe_cat Fluffy_Pillow 129.4/150: 86% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, raid_movement, dash, incarnation_king_of_the_jungle, predatory_swiftness, scent_of_blood, potion_of_the_old_war
0:21.787 auto_attack Fluffy_Pillow 112.9/150: 75% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, dash, incarnation_king_of_the_jungle, predatory_swiftness, scent_of_blood, potion_of_the_old_war
0:22.291 rip Fluffy_Pillow_Add1 127.7/150: 85% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, dash, incarnation_king_of_the_jungle, predatory_swiftness, scent_of_blood, potion_of_the_old_war
0:23.296 swipe_cat Fluffy_Pillow 127.6/150: 85% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, dash, incarnation_king_of_the_jungle, predatory_swiftness, scent_of_blood
0:24.300 swipe_cat Fluffy_Pillow 125.9/150: 84% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points bloodlust, clearcasting, dash, incarnation_king_of_the_jungle, predatory_swiftness
0:25.305 swipe_cat Fluffy_Pillow 140.7/150: 94% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, clearcasting, dash, incarnation_king_of_the_jungle, predatory_swiftness
0:26.308 swipe_cat Fluffy_Pillow 150.0/150: 100% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points bloodlust, dash, incarnation_king_of_the_jungle, predatory_swiftness
0:27.312 swipe_cat Fluffy_Pillow 142.3/150: 95% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points bloodlust, dash, incarnation_king_of_the_jungle, predatory_swiftness
0:28.318 thrash_cat Fluffy_Pillow 134.6/150: 90% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, raid_movement, dash, incarnation_king_of_the_jungle, predatory_swiftness
0:28.618 auto_attack Fluffy_Pillow 109.6/150: 73% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, dash, incarnation_king_of_the_jungle, predatory_swiftness, scent_of_blood
0:29.323 rip Fluffy_Pillow 124.5/150: 83% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, dash, incarnation_king_of_the_jungle, predatory_swiftness, scent_of_blood
0:30.329 swipe_cat Fluffy_Pillow 124.3/150: 83% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, dash, incarnation_king_of_the_jungle, predatory_swiftness, scent_of_blood
0:31.333 swipe_cat Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points bloodlust, dash, predatory_swiftness, scent_of_blood
0:32.338 swipe_cat Fluffy_Pillow 81.8/100: 82% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, dash, predatory_swiftness
0:33.343 swipe_cat Fluffy_Pillow 51.6/100: 52% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points bloodlust, dash, predatory_swiftness
0:34.347 tigers_fury Fluffy_Pillow 21.4/100: 21% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points bloodlust, dash, predatory_swiftness
0:34.601 swipe_cat Fluffy_Pillow 45.2/100: 45% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points bloodlust, dash, ashamanes_energy, predatory_swiftness, tigers_fury
0:35.605 ferocious_bite Fluffy_Pillow_Add1 35.0/100: 35% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, predatory_swiftness, tigers_fury
0:37.377 thrash_cat Fluffy_Pillow 66.1/100: 66% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, predatory_swiftness, tigers_fury
0:38.637 swipe_cat Fluffy_Pillow 34.7/100: 35% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, predatory_swiftness, scent_of_blood, tigers_fury
0:40.920 rake Fluffy_Pillow 35.4/100: 35% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, predatory_swiftness, scent_of_blood, tigers_fury
0:41.925 Waiting 1.565 sec 11.8/100: 12% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, tigers_fury
0:43.490 lunar_inspiration Fluffy_Pillow 29.5/100: 30% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points clearcasting, predatory_swiftness
0:44.494 Waiting 0.300 sec 40.9/100: 41% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points raid_movement, predatory_swiftness
0:44.794 auto_attack Fluffy_Pillow 44.3/100: 44% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
0:44.794 shred Fluffy_Pillow 44.3/100: 44% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
0:45.800 Waiting 2.216 sec 15.7/100: 16% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
0:48.016 shred Fluffy_Pillow 40.9/100: 41% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points
0:49.020 Waiting 1.123 sec 12.3/100: 12% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points
0:50.143 wild_charge Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points raid_movement
0:50.652 auto_attack Fluffy_Pillow 30.8/100: 31% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points wild_charge_movement
0:52.438 thrash_cat Fluffy_Pillow 51.0/100: 51% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points
0:55.479 swipe_cat Fluffy_Pillow 35.5/100: 36% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points scent_of_blood
0:58.016 rip Fluffy_Pillow 31.3/100: 31% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points
1:00.808 auto_attack Fluffy_Pillow 33.0/100: 33% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness
1:02.340 thrash_cat Fluffy_Pillow 50.4/100: 50% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness
1:04.111 tigers_fury Fluffy_Pillow 20.4/100: 20% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, scent_of_blood
1:04.347 swipe_cat Fluffy_Pillow 43.1/100: 43% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, scent_of_blood, tigers_fury
1:05.351 swipe_cat Fluffy_Pillow 41.5/100: 42% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, scent_of_blood, tigers_fury
1:06.869 swipe_cat Fluffy_Pillow 45.7/100: 46% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
1:09.155 swipe_cat Fluffy_Pillow 46.7/100: 47% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points predatory_swiftness, tigers_fury
1:11.435 rake Fluffy_Pillow 27.5/100: 28% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points clearcasting, tigers_fury
1:12.440 Waiting 1.700 sec 38.9/100: 39% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points
1:14.140 rip Fluffy_Pillow 58.2/100: 58% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points
1:15.147 lunar_inspiration Fluffy_Pillow 39.6/100: 40% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness
1:16.152 wild_charge Fluffy_Pillow 21.0/100: 21% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points raid_movement, predatory_swiftness
1:16.152 Waiting 0.350 sec 21.0/100: 21% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points raid_movement, wild_charge_movement, predatory_swiftness
1:16.502 auto_attack Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
1:16.502 Waiting 1.400 sec 25.0/100: 25% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
1:17.902 shred Fluffy_Pillow 40.9/100: 41% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
1:18.907 Waiting 1.121 sec 12.3/100: 12% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
1:22.322 thrash_cat Fluffy_Pillow 51.0/100: 51% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points raid_movement, predatory_swiftness
1:22.522 auto_attack Fluffy_Pillow 1.0/100: 1% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, scent_of_blood
1:23.582 swipe_cat Fluffy_Pillow 15.3/100: 15% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, scent_of_blood
1:24.587 swipe_cat Fluffy_Pillow 38.7/100: 39% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, scent_of_blood
1:25.591 swipe_cat Fluffy_Pillow 62.1/100: 62% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, scent_of_blood
1:26.596 rip Fluffy_Pillow_Add1 40.5/100: 40% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points
1:28.877 swipe_cat Fluffy_Pillow 36.4/100: 36% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, predatory_swiftness
1:30.136 thrash_cat Fluffy_Pillow 50.7/100: 51% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
1:32.163 wild_charge Fluffy_Pillow 23.6/100: 24% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points raid_movement, predatory_swiftness, scent_of_blood
1:32.263 auto_attack Fluffy_Pillow 23.6/100: 24% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points wild_charge_movement, predatory_swiftness, scent_of_blood
1:33.183 swipe_cat Fluffy_Pillow 35.2/100: 35% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, scent_of_blood
1:34.187 tigers_fury Fluffy_Pillow 13.6/100: 14% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
1:35.368 swipe_cat Fluffy_Pillow 67.0/100: 67% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
1:36.374 swipe_cat Fluffy_Pillow 53.4/100: 53% energy | 704000.0/704000: 100% mana | 2.0/5: 41% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
1:37.888 swipe_cat Fluffy_Pillow 45.6/100: 46% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points predatory_swiftness, tigers_fury
1:40.933 rake Fluffy_Pillow 35.1/100: 35% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points tigers_fury
1:41.938 rip Fluffy_Pillow 11.5/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, tigers_fury
1:42.941 Waiting 0.684 sec 22.9/100: 23% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness
1:43.625 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness
1:44.629 Waiting 2.541 sec 12.1/100: 12% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
1:47.170 shred Fluffy_Pillow 40.9/100: 41% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
1:48.174 wild_charge Fluffy_Pillow 12.3/100: 12% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points raid_movement, predatory_swiftness
1:48.174 Waiting 1.122 sec 12.3/100: 12% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points raid_movement, wild_charge_movement, predatory_swiftness
1:49.296 auto_attack Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
1:49.296 Waiting 0.800 sec 25.0/100: 25% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
1:51.628 thrash_cat Fluffy_Pillow 51.4/100: 51% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points raid_movement, predatory_swiftness
1:52.528 auto_attack Fluffy_Pillow 1.4/100: 1% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, scent_of_blood
1:53.656 swipe_cat Fluffy_Pillow 24.5/100: 24% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points clearcasting, predatory_swiftness, scent_of_blood, acceleration
1:54.660 swipe_cat Fluffy_Pillow 50.1/100: 50% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points scent_of_blood, acceleration
1:56.940 swipe_cat Fluffy_Pillow 47.9/100: 48% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points acceleration
1:57.944 rip Fluffy_Pillow_Add1 16.5/100: 17% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, acceleration
2:00.485 thrash_cat Fluffy_Pillow 50.9/100: 51% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, acceleration
2:01.745 swipe_cat Fluffy_Pillow 17.9/100: 18% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, predatory_swiftness, scent_of_blood, acceleration
2:02.750 swipe_cat Fluffy_Pillow 43.5/100: 44% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, scent_of_blood, acceleration
2:04.008 wild_charge Fluffy_Pillow 26.8/100: 27% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points raid_movement, predatory_swiftness, scent_of_blood
2:04.208 auto_attack Fluffy_Pillow 26.8/100: 27% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, scent_of_blood
2:04.264 tigers_fury Fluffy_Pillow 29.7/100: 30% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, scent_of_blood
2:04.347 swipe_cat Fluffy_Pillow 50.6/100: 51% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, scent_of_blood, tigers_fury
2:05.352 swipe_cat Fluffy_Pillow 49.0/100: 49% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
2:06.869 swipe_cat Fluffy_Pillow 41.2/100: 41% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points clearcasting, ashamanes_energy, predatory_swiftness, tigers_fury
2:07.873 rip Fluffy_Pillow 72.6/100: 73% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury
2:08.875 thrash_cat Fluffy_Pillow 54.0/100: 54% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, tigers_fury
2:11.672 rake Fluffy_Pillow 35.7/100: 36% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, scent_of_blood, tigers_fury
2:12.676 Waiting 1.638 sec 12.1/100: 12% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, scent_of_blood
2:14.314 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
2:15.319 Waiting 2.540 sec 12.1/100: 12% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
2:17.859 shred Fluffy_Pillow 40.9/100: 41% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
2:18.863 Waiting 1.222 sec 12.3/100: 12% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
2:20.085 wild_charge Fluffy_Pillow 26.1/100: 26% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points raid_movement
2:20.185 auto_attack Fluffy_Pillow 26.1/100: 26% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points wild_charge_movement
2:22.383 thrash_cat Fluffy_Pillow 52.2/100: 52% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points
2:23.387 swipe_cat Fluffy_Pillow 13.6/100: 14% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points clearcasting, scent_of_blood
2:24.390 swipe_cat Fluffy_Pillow 37.0/100: 37% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points scent_of_blood
2:26.417 swipe_cat Fluffy_Pillow 27.0/100: 27% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points clearcasting
2:27.421 rip Fluffy_Pillow 38.3/100: 38% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points
2:30.986 thrash_cat Fluffy_Pillow 51.2/100: 51% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, acceleration
2:33.527 swipe_cat Fluffy_Pillow 35.6/100: 36% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, scent_of_blood, acceleration
2:34.531 tigers_fury Fluffy_Pillow 16.2/100: 16% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, scent_of_blood, acceleration
2:34.531 swipe_cat Fluffy_Pillow 36.2/100: 36% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, scent_of_blood, tigers_fury, acceleration
2:36.049 wild_charge Fluffy_Pillow 43.7/100: 44% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points raid_movement, ashamanes_energy, predatory_swiftness, tigers_fury, acceleration
2:36.249 auto_attack Fluffy_Pillow 43.7/100: 44% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, tigers_fury, acceleration
2:36.303 swipe_cat Fluffy_Pillow 47.2/100: 47% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, tigers_fury, acceleration
2:37.563 swipe_cat Fluffy_Pillow 59.2/100: 59% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points predatory_swiftness, tigers_fury, acceleration
2:39.336 swipe_cat Fluffy_Pillow 38.2/100: 38% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points clearcasting, predatory_swiftness, tigers_fury, acceleration
2:40.341 rip Fluffy_Pillow 50.8/100: 51% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points tigers_fury
2:41.602 rake Fluffy_Pillow 35.1/100: 35% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, tigers_fury
2:42.607 Waiting 1.691 sec 11.5/100: 11% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
2:44.298 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
2:45.301 Waiting 2.542 sec 12.0/100: 12% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
2:47.843 shred Fluffy_Pillow 40.9/100: 41% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
2:48.847 Waiting 1.222 sec 12.3/100: 12% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
2:50.834 wild_charge Fluffy_Pillow 34.8/100: 35% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points raid_movement, predatory_swiftness
2:51.404 auto_attack Fluffy_Pillow 40.1/100: 40% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
2:52.321 thrash_cat Fluffy_Pillow 51.7/100: 52% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points raid_movement, predatory_swiftness
2:52.421 auto_attack Fluffy_Pillow 1.7/100: 2% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points scent_of_blood
2:55.116 swipe_cat Fluffy_Pillow 33.4/100: 33% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points scent_of_blood
2:56.122 rip Fluffy_Pillow_Add1 11.8/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, scent_of_blood
2:57.897 swipe_cat Fluffy_Pillow 31.9/100: 32% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, predatory_swiftness
2:59.156 swipe_cat Fluffy_Pillow 46.2/100: 46% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
3:02.201 incarnation Fluffy_Pillow 35.7/100: 36% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
3:02.201 thrash_cat Fluffy_Pillow 35.7/150: 24% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness
3:03.205 swipe_cat Fluffy_Pillow 22.1/150: 15% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, scent_of_blood
3:04.209 swipe_cat Fluffy_Pillow 17.0/150: 11% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, scent_of_blood
3:05.214 tigers_fury Fluffy_Pillow 11.9/150: 8% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, scent_of_blood
3:05.214 swipe_cat Fluffy_Pillow 31.9/150: 21% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points incarnation_king_of_the_jungle, feral_instinct, ashamanes_energy, predatory_swiftness, scent_of_blood, tigers_fury
3:06.218 rip Fluffy_Pillow 46.8/150: 31% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, feral_instinct, ashamanes_energy, predatory_swiftness, tigers_fury
3:07.222 swipe_cat Fluffy_Pillow 65.4/150: 44% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points incarnation_king_of_the_jungle, feral_instinct, ashamanes_energy, predatory_swiftness, tigers_fury, acceleration
3:08.225 wild_charge Fluffy_Pillow 76.5/150: 51% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points raid_movement, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury, acceleration
3:08.225 swipe_cat Fluffy_Pillow 76.5/150: 51% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points raid_movement, wild_charge_movement, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury, acceleration
3:08.425 auto_attack Fluffy_Pillow 54.0/150: 36% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury, acceleration
3:09.229 swipe_cat Fluffy_Pillow 67.6/150: 45% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury, acceleration
3:10.232 rake Fluffy_Pillow 58.6/150: 39% energy | 704000.0/704000: 100% mana | 2.0/5: 41% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury, acceleration
3:11.235 lunar_inspiration Fluffy_Pillow 54.7/150: 36% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury, acceleration
3:12.240 ferocious_bite Fluffy_Pillow 53.3/150: 36% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury, acceleration
3:13.244 shred Fluffy_Pillow 41.9/150: 28% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, acceleration
3:14.247 shred Fluffy_Pillow 35.5/150: 24% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, acceleration
3:15.253 shred Fluffy_Pillow 29.1/150: 19% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points clearcasting, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, acceleration
3:16.257 rip Fluffy_Pillow 42.7/150: 28% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, acceleration
3:17.262 shred Fluffy_Pillow 41.3/150: 28% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points incarnation_king_of_the_jungle, predatory_swiftness, acceleration
3:18.268 shred Fluffy_Pillow 34.9/150: 23% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points incarnation_king_of_the_jungle, predatory_swiftness, acceleration
3:19.270 shred Fluffy_Pillow 28.4/150: 19% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points clearcasting, incarnation_king_of_the_jungle, predatory_swiftness, acceleration
3:20.273 dash Fluffy_Pillow 42.0/150: 28% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, incarnation_king_of_the_jungle, predatory_swiftness, acceleration
3:20.282 thrash_cat Fluffy_Pillow 42.1/150: 28% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, dash, incarnation_king_of_the_jungle, predatory_swiftness, acceleration
3:21.285 swipe_cat Fluffy_Pillow 30.7/150: 20% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, dash, incarnation_king_of_the_jungle, predatory_swiftness, scent_of_blood, acceleration
3:21.785 auto_attack Fluffy_Pillow 14.2/150: 9% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points dash, incarnation_king_of_the_jungle, predatory_swiftness, scent_of_blood, acceleration
3:22.291 rip Fluffy_Pillow_Add1 27.8/150: 19% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points dash, incarnation_king_of_the_jungle, predatory_swiftness, scent_of_blood, acceleration
3:23.297 swipe_cat Fluffy_Pillow 25.1/150: 17% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, dash, incarnation_king_of_the_jungle, predatory_swiftness, scent_of_blood
3:24.301 swipe_cat Fluffy_Pillow 42.5/150: 28% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points raid_movement, dash, incarnation_king_of_the_jungle, predatory_swiftness
3:24.601 auto_attack Fluffy_Pillow 20.0/150: 13% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points dash, incarnation_king_of_the_jungle, predatory_swiftness
3:25.305 swipe_cat Fluffy_Pillow 31.4/150: 21% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points dash, incarnation_king_of_the_jungle, predatory_swiftness
3:26.567 swipe_cat Fluffy_Pillow 23.2/150: 15% energy | 704000.0/704000: 100% mana | 2.0/5: 41% combo_points dash, incarnation_king_of_the_jungle, predatory_swiftness
3:28.852 thrash_cat Fluffy_Pillow 26.7/150: 18% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points dash, incarnation_king_of_the_jungle, predatory_swiftness
3:30.368 swipe_cat Fluffy_Pillow 18.9/150: 13% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points dash, incarnation_king_of_the_jungle, predatory_swiftness, scent_of_blood
3:31.630 swipe_cat Fluffy_Pillow 16.7/150: 11% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points dash, incarnation_king_of_the_jungle, predatory_swiftness, scent_of_blood
3:33.661 swipe_cat Fluffy_Pillow 23.2/100: 23% energy | 704000.0/704000: 100% mana | 4.1/5: 81% combo_points clearcasting, dash, predatory_swiftness
3:34.666 rip Fluffy_Pillow 34.6/100: 35% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points dash
3:35.669 tigers_fury Fluffy_Pillow 16.0/100: 16% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, predatory_swiftness
3:35.669 swipe_cat Fluffy_Pillow 36.0/100: 36% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, ashamanes_energy, predatory_swiftness, tigers_fury
3:36.675 ferocious_bite Fluffy_Pillow_Add1 67.4/100: 67% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points clearcasting, ashamanes_energy, predatory_swiftness, tigers_fury
3:37.680 thrash_cat Fluffy_Pillow 73.8/100: 74% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
3:38.684 swipe_cat Fluffy_Pillow 55.2/100: 55% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, scent_of_blood, tigers_fury
3:39.688 swipe_cat Fluffy_Pillow 33.6/100: 34% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, scent_of_blood, tigers_fury
3:40.693 Waiting 1.148 sec 12.0/100: 12% energy | 704000.0/704000: 100% mana | 2.0/5: 41% combo_points raid_movement, predatory_swiftness, scent_of_blood, tigers_fury
3:41.841 auto_attack Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 2.0/5: 41% combo_points predatory_swiftness, tigers_fury
3:42.863 rake Fluffy_Pillow 36.6/100: 37% energy | 704000.0/704000: 100% mana | 2.0/5: 41% combo_points predatory_swiftness, tigers_fury
3:43.869 Waiting 1.557 sec 13.0/100: 13% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points predatory_swiftness
3:45.426 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points predatory_swiftness
3:46.431 Waiting 3.640 sec 12.1/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness
3:50.071 wild_charge Fluffy_Pillow 53.4/100: 53% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement
3:50.071 thrash_cat Fluffy_Pillow 53.4/100: 53% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, wild_charge_movement
3:50.571 auto_attack Fluffy_Pillow 3.4/100: 3% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points wild_charge_movement, scent_of_blood
3:52.610 rip Fluffy_Pillow_Add1 32.2/100: 32% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points scent_of_blood
3:54.126 swipe_cat Fluffy_Pillow 19.3/100: 19% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, predatory_swiftness
3:56.405 swipe_cat Fluffy_Pillow 45.2/100: 45% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points raid_movement, predatory_swiftness
3:56.805 auto_attack Fluffy_Pillow 0.2/100: 0% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
4:00.988 thrash_cat Fluffy_Pillow 52.2/100: 52% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
4:03.777 swipe_cat Fluffy_Pillow 33.8/100: 34% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, scent_of_blood
4:05.549 tigers_fury Fluffy_Pillow 20.9/100: 21% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points
4:05.925 ferocious_bite Fluffy_Pillow_Add1 45.2/100: 45% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points ashamanes_energy, tigers_fury
4:07.697 swipe_cat Fluffy_Pillow 60.1/100: 60% energy | 704000.0/704000: 100% mana | 0.0/5: 1% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
4:09.212 thrash_cat Fluffy_Pillow 52.3/100: 52% energy | 704000.0/704000: 100% mana | 1.0/5: 21% combo_points predatory_swiftness, tigers_fury
4:12.002 wild_charge Fluffy_Pillow 33.9/100: 34% energy | 704000.0/704000: 100% mana | 1.0/5: 21% combo_points raid_movement, predatory_swiftness, scent_of_blood, tigers_fury
4:12.002 lunar_inspiration Fluffy_Pillow 33.9/100: 34% energy | 704000.0/704000: 100% mana | 1.0/5: 21% combo_points raid_movement, wild_charge_movement, predatory_swiftness, scent_of_blood, tigers_fury
4:12.202 auto_attack Fluffy_Pillow 3.9/100: 4% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points predatory_swiftness, scent_of_blood, tigers_fury
4:14.798 rake Fluffy_Pillow 37.9/100: 38% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points predatory_swiftness, acceleration
4:15.801 Waiting 1.829 sec 16.5/100: 16% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points predatory_swiftness, acceleration
4:17.630 shred Fluffy_Pillow 41.2/100: 41% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points predatory_swiftness, acceleration
4:18.635 Waiting 1.151 sec 14.8/100: 15% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points acceleration
4:19.786 rip Fluffy_Pillow 30.4/100: 30% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points acceleration
4:22.525 auto_attack Fluffy_Pillow 34.8/100: 35% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, acceleration
4:23.604 thrash_cat Fluffy_Pillow 52.1/100: 52% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, acceleration
4:26.400 swipe_cat Fluffy_Pillow 34.1/100: 34% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, scent_of_blood
4:28.171 wild_charge Fluffy_Pillow 21.2/100: 21% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points raid_movement, predatory_swiftness
4:28.271 auto_attack Fluffy_Pillow 21.2/100: 21% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points wild_charge_movement, predatory_swiftness
4:30.466 swipe_cat Fluffy_Pillow 47.3/100: 47% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
4:34.798 thrash_cat Fluffy_Pillow 51.4/100: 51% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points
4:35.805 tigers_fury Fluffy_Pillow 12.8/100: 13% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points scent_of_blood
4:36.061 swipe_cat Fluffy_Pillow 35.7/100: 36% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points ashamanes_energy, scent_of_blood, tigers_fury
4:37.065 swipe_cat Fluffy_Pillow 34.1/100: 34% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points ashamanes_energy, scent_of_blood, tigers_fury
4:38.324 swipe_cat Fluffy_Pillow 35.4/100: 35% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points ashamanes_energy, scent_of_blood, tigers_fury
4:39.838 swipe_cat Fluffy_Pillow 39.6/100: 40% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points clearcasting, tigers_fury
4:40.843 rip Fluffy_Pillow 51.0/100: 51% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points tigers_fury
4:42.103 rake Fluffy_Pillow 35.3/100: 35% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, tigers_fury
4:43.110 Waiting 1.173 sec 11.7/100: 12% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, tigers_fury
4:44.283 wild_charge Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points raid_movement, predatory_swiftness
4:44.283 Waiting 0.100 sec 25.0/100: 25% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points raid_movement, wild_charge_movement, predatory_swiftness
4:44.383 auto_attack Fluffy_Pillow 26.1/100: 26% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points wild_charge_movement, predatory_swiftness
4:44.383 Waiting 0.400 sec 26.1/100: 26% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points wild_charge_movement, predatory_swiftness
4:44.783 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
4:45.787 Waiting 2.541 sec 12.1/100: 12% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
4:48.328 shred Fluffy_Pillow 40.9/100: 41% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
4:49.332 Waiting 1.122 sec 12.3/100: 12% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
4:52.500 auto_attack Fluffy_Pillow 48.2/100: 48% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
4:52.755 thrash_cat Fluffy_Pillow 51.1/100: 51% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
4:55.803 swipe_cat Fluffy_Pillow 35.7/100: 36% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points scent_of_blood
4:58.343 rip Fluffy_Pillow 31.5/100: 31% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points
4:59.347 swipe_cat Fluffy_Pillow 12.9/100: 13% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, predatory_swiftness
5:00.810 auto_attack Fluffy_Pillow 27.2/100: 27% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
5:02.657 thrash_cat Fluffy_Pillow 50.4/100: 50% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
5:05.704 tigers_fury Fluffy_Pillow 35.0/100: 35% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, scent_of_blood
5:05.805 swipe_cat Fluffy_Pillow 56.1/100: 56% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, scent_of_blood, tigers_fury
5:06.811 swipe_cat Fluffy_Pillow 54.5/100: 55% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
5:07.816 swipe_cat Fluffy_Pillow 40.9/100: 41% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points clearcasting, ashamanes_energy, predatory_swiftness, tigers_fury
5:08.821 swipe_cat Fluffy_Pillow 72.3/100: 72% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points predatory_swiftness, tigers_fury
5:09.826 rip Fluffy_Pillow_Add1 38.7/100: 39% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, tigers_fury
5:12.364 rake Fluffy_Pillow 37.5/100: 38% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, tigers_fury
5:13.368 Waiting 1.477 sec 13.9/100: 14% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, tigers_fury
5:14.845 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
5:15.850 Waiting 1.139 sec 12.1/100: 12% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
5:16.989 auto_attack Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
5:16.989 Waiting 1.400 sec 25.0/100: 25% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
5:18.389 shred Fluffy_Pillow 40.9/100: 41% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
5:19.394 Waiting 2.522 sec 12.3/100: 12% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
5:21.916 shred Fluffy_Pillow 40.9/100: 41% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points
5:24.959 rake Fluffy_Pillow 35.4/100: 35% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points
5:25.963 Waiting 1.665 sec 11.8/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points
5:27.628 rip Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points
5:28.632 Waiting 1.640 sec 12.1/100: 12% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness
5:30.272 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness
5:31.276 Waiting 1.541 sec 12.1/100: 12% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
5:32.817 auto_attack Fluffy_Pillow 29.5/100: 30% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
5:32.817 Waiting 1.000 sec 29.5/100: 30% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
5:33.817 shred Fluffy_Pillow 40.9/100: 41% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness
5:34.823 Waiting 1.120 sec 12.3/100: 12% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
5:35.943 tigers_fury Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
5:35.943 rake Fluffy_Pillow 45.0/100: 45% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
5:36.948 shred Fluffy_Pillow 41.4/100: 41% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
5:37.952 Waiting 0.700 sec 32.8/100: 33% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points ashamanes_energy, predatory_swiftness, tigers_fury
5:38.652 rip Fluffy_Pillow 40.7/100: 41% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, ashamanes_energy, predatory_swiftness, tigers_fury
5:39.656 shred Fluffy_Pillow 72.1/100: 72% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, tigers_fury
5:40.662 lunar_inspiration Fluffy_Pillow 43.5/100: 44% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, tigers_fury
5:41.667 Waiting 1.400 sec 24.9/100: 25% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, tigers_fury
5:43.067 shred Fluffy_Pillow 40.8/100: 41% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, tigers_fury
5:44.073 Waiting 1.927 sec 12.2/100: 12% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
5:46.256 rake Fluffy_Pillow 37.0/100: 37% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points clearcasting, predatory_swiftness
5:47.260 Waiting 0.800 sec 48.4/100: 48% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness
5:48.060 wild_charge Fluffy_Pillow 57.4/100: 57% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, predatory_swiftness
5:48.060 Waiting 0.200 sec 57.4/100: 57% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, wild_charge_movement, predatory_swiftness
5:48.260 auto_attack Fluffy_Pillow 59.7/100: 60% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness
5:48.260 Waiting 2.600 sec 59.7/100: 60% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness
5:50.860 ferocious_bite Fluffy_Pillow 89.2/100: 89% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points
5:51.865 shred Fluffy_Pillow 50.6/100: 51% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, predatory_swiftness
5:52.870 shred Fluffy_Pillow 62.0/100: 62% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness
5:53.874 Waiting 0.200 sec 33.4/100: 33% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
5:54.074 lunar_inspiration Fluffy_Pillow 35.7/100: 36% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness
5:55.078 Waiting 1.301 sec 17.0/100: 17% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
5:56.890 rake Fluffy_Pillow 37.6/100: 38% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness
5:57.894 Waiting 4.070 sec 14.0/100: 14% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness
6:01.964 incarnation Fluffy_Pillow 60.2/100: 60% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness
6:02.201 potion Fluffy_Pillow 62.8/150: 42% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness
6:02.201 ferocious_bite Fluffy_Pillow 62.8/150: 42% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
6:03.206 shred Fluffy_Pillow 49.2/150: 33% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
6:04.210 wild_charge Fluffy_Pillow 40.6/150: 27% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points raid_movement, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
6:04.210 Waiting 0.200 sec 40.6/150: 27% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points raid_movement, wild_charge_movement, incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
6:04.410 auto_attack Fluffy_Pillow 42.9/150: 29% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
6:04.410 shred Fluffy_Pillow 42.9/150: 29% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
6:05.415 shred Fluffy_Pillow 34.3/150: 23% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
6:06.421 tigers_fury Fluffy_Pillow 26.3/150: 18% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, acceleration, potion_of_the_old_war
6:06.421 ferocious_bite Fluffy_Pillow 46.3/150: 31% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, feral_instinct, ashamanes_energy, predatory_swiftness, tigers_fury, acceleration, potion_of_the_old_war
6:07.424 rake Fluffy_Pillow 54.8/150: 37% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points incarnation_king_of_the_jungle, feral_instinct, ashamanes_energy, predatory_swiftness, tigers_fury, acceleration, potion_of_the_old_war
6:08.430 lunar_inspiration Fluffy_Pillow 70.9/150: 47% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points incarnation_king_of_the_jungle, feral_instinct, ashamanes_energy, predatory_swiftness, tigers_fury, acceleration, potion_of_the_old_war
6:09.434 shred Fluffy_Pillow 89.5/150: 60% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury, acceleration, potion_of_the_old_war
6:10.440 ferocious_bite Fluffy_Pillow 83.1/150: 55% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury, acceleration, potion_of_the_old_war
6:11.443 shred Fluffy_Pillow 71.7/150: 48% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury, acceleration, potion_of_the_old_war
6:12.448 shred Fluffy_Pillow 65.3/150: 44% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury, acceleration, potion_of_the_old_war
6:13.453 shred Fluffy_Pillow 58.9/150: 39% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, tigers_fury, acceleration, potion_of_the_old_war
6:14.459 ferocious_bite Fluffy_Pillow 52.5/150: 35% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, acceleration, potion_of_the_old_war
6:15.464 shred Fluffy_Pillow 41.1/150: 27% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, acceleration, potion_of_the_old_war
6:16.468 shred Fluffy_Pillow 34.1/150: 23% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points incarnation_king_of_the_jungle, feral_instinct, predatory_swiftness, potion_of_the_old_war
6:17.472 shred Fluffy_Pillow 25.5/150: 17% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
6:18.475 Waiting 0.820 sec 16.8/150: 11% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
6:19.295 ferocious_bite Fluffy_Pillow 26.1/150: 17% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
6:20.298 wild_charge Fluffy_Pillow 12.5/150: 8% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points raid_movement, incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
6:20.298 Waiting 1.101 sec 12.5/150: 8% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points raid_movement, wild_charge_movement, incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
6:21.399 auto_attack Fluffy_Pillow 25.0/150: 17% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
6:21.399 rake Fluffy_Pillow 25.0/150: 17% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
6:22.404 lunar_inspiration Fluffy_Pillow 18.9/150: 13% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points clearcasting, incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
6:23.409 shred Fluffy_Pillow 30.3/150: 20% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points incarnation_king_of_the_jungle, predatory_swiftness, potion_of_the_old_war
6:24.414 Waiting 0.255 sec 22.9/150: 15% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, predatory_swiftness, acceleration, potion_of_the_old_war
6:24.669 ferocious_bite Fluffy_Pillow 26.3/150: 18% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points incarnation_king_of_the_jungle, predatory_swiftness, acceleration, potion_of_the_old_war
6:25.675 Waiting 0.741 sec 15.0/150: 10% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points incarnation_king_of_the_jungle, predatory_swiftness, acceleration, potion_of_the_old_war
6:26.416 shred Fluffy_Pillow 25.0/150: 17% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points incarnation_king_of_the_jungle, predatory_swiftness, acceleration, potion_of_the_old_war
6:27.420 Waiting 0.474 sec 18.6/150: 12% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points incarnation_king_of_the_jungle, predatory_swiftness, acceleration
6:27.894 shred Fluffy_Pillow 25.0/150: 17% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points incarnation_king_of_the_jungle, predatory_swiftness, acceleration
6:28.900 Waiting 0.472 sec 18.6/150: 12% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points incarnation_king_of_the_jungle, predatory_swiftness, acceleration
6:29.372 shred Fluffy_Pillow 25.0/150: 17% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points clearcasting, incarnation_king_of_the_jungle, predatory_swiftness, acceleration
6:30.376 ferocious_bite Fluffy_Pillow 38.6/150: 26% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, incarnation_king_of_the_jungle, predatory_swiftness, acceleration
6:31.380 shred Fluffy_Pillow 39.7/150: 26% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points incarnation_king_of_the_jungle, predatory_swiftness, acceleration
6:32.638 rake Fluffy_Pillow 36.7/100: 37% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, acceleration
6:33.645 Waiting 1.916 sec 15.3/100: 15% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, acceleration
6:35.561 shred Fluffy_Pillow 40.3/100: 40% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, acceleration

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 25122 23416 13274 (11720)
Stamina 35285 35285 21087
Intellect 7651 7326 0
Spirit 0 0 0
Health 2117100 2117100 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 30146 28099 0
Crit 31.87% 31.87% 5904
Haste 13.43% 13.43% 4366
Damage / Heal Versatility 5.70% 5.70% 2279
Attack Power 25122 23416 0
Mastery 66.14% 64.00% 8400
Armor 2125 2125 2125
Run Speed 10 0 0
Leech 1.76% 1.76% 404

Gear

Source Slot Average Item Level: 859.00
Local Head Biornskin Hood
ilevel: 865, stats: { 281 Armor, +1491 AgiInt, +2237 Sta, +809 Crit, +571 Mastery }
Local Neck Strand of the Stars
ilevel: 840, stats: { +997 Sta, +960 Vers, +808 Mastery }
Local Shoulders Otherworldy Leather Mantle
ilevel: 850, stats: { 247 Armor, +1459 Sta, +973 AgiInt, +594 Crit, +385 Mastery }, gems: { +150 Mastery }
Local Chest Ekowraith, Creator of Worlds
ilevel: 895, stats: { 382 Armor, +2959 Sta, +1973 AgiInt, +552 Crit, +993 Mastery }
Local Waist Swordsinger's Belt
ilevel: 865, stats: { 195 Armor, +1119 AgiInt, +1678 Sta, +628 Mastery, +407 Haste, +638 unknown }
Local Legs Felbat Leather Leggings
ilevel: 850, stats: { 288 Armor, +1297 AgiInt, +1945 Sta, +792 Crit, +512 Vers }
Local Feet Mana-Tanned Sandals
ilevel: 875, stats: { 246 Armor, +1842 Sta, +1228 AgiInt, +744 Mastery, +330 Crit }
Local Wrists Wax-Sealed Leather Bracers
ilevel: 860, stats: { 149 Armor, +1201 Sta, +801 AgiInt, +545 Haste, +218 Crit }
Local Hands Raven's Veil Gloves
ilevel: 855, stats: { 209 Armor, +1019 AgiInt, +1529 Sta, +627 Mastery, +370 Crit }
Local Finger1 Jeweled Signet of Melandrus
ilevel: 840, stats: { +997 Sta, +960 Haste, +808 Crit }, enchant: { +150 Mastery }
Local Finger2 Mindrend Band
ilevel: 850, stats: { +1094 Sta, +1154 Mastery, +682 Haste }, enchant: { +150 Mastery }
Local Trinket1 Chrono Shard
ilevel: 840, stats: { +1123 StrAgiInt, +404 Leech }
Local Trinket2 Unstable Arcanocrystal
ilevel: 860, stats: { +807 Vers, +807 Mastery, +807 Crit, +807 Haste }
Local Back Nightborne Noble's Cloak
ilevel: 845, stats: { 128 Armor, +696 StrAgiInt, +1045 Sta, +483 Mastery, +237 Haste }, gems: { +150 Mastery }, enchant: { +150 Agi }
Local Main Hand Fangs of Ashamane
ilevel: 875, weapon: { 2879 - 5349, 1.8 }, stats: { +702 Agi, +1052 Sta, +312 Crit, +300 Mastery }, relics: { +40 ilevels, +42 ilevels, +43 ilevels }
Local Off Hand Fangs of Ashamane
ilevel: 875, weapon: { 2879 - 5349, 1.8 }, stats: { +702 Agi, +1052 Sta, +312 Crit, +300 Mastery }

Talents

Level
15 Predator (Feral Druid) Blood Scent (Feral Druid) Lunar Inspiration (Feral Druid)
30 Renewal Displacer Beast Wild Charge
45 Balance Affinity Guardian Affinity (Feral Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Savage Roar (Feral Druid)
90 Sabertooth (Feral Druid) Jagged Wounds (Feral Druid) Elune's Guidance (Feral Druid)
100 Brutal Slash (Feral Druid) Bloodtalons (Feral Druid) Moment of Clarity (Feral Druid)

Profile

druid="Oinkie"
origin="https://us.api.battle.net/wow/character/thrall/Oinkie/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/231/133784295-avatar.jpg"
level=110
race=tauren
role=attack
position=back
professions=inscription=713/herbalism=815
talents=3311222
artifact=58:0:0:0:0:1153:1:1154:1:1156:1:1157:1:1158:1:1161:3:1162:3:1163:3:1164:3:1165:3:1166:3:1167:2:1327:1
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=dash,if=!buff.cat_form.up
actions+=/cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/berserk,if=buff.tigers_fury.up
actions+=/incarnation,if=cooldown.tigers_fury.remains<gcd
actions+=/potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
actions+=/tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
actions+=/incarnation,if=energy.time_to_max>1&energy>=35
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
actions+=/call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
actions+=/call_action_list,name=finisher
actions+=/call_action_list,name=generator

# Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
actions.finisher=pool_resource,for_next=1
actions.finisher+=/savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
# Thrash has higher priority than finishers at 5 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
# Replace Rip with Swipe at 8 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/swipe_cat,if=spell_targets.swipe_cat>=8
# Refresh Rip at 8 seconds or for a stronger Rip
actions.finisher+=/rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Refresh Savage Roar early with Jagged Wounds
actions.finisher+=/savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
actions.finisher+=/swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.finisher+=/ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))

# Brutal Slash if there's adds up
actions.generator=brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
actions.generator+=/ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
# Pool energy for Elune's Guidance when it's coming off cooldown.
actions.generator+=/pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
actions.generator+=/elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
# Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
# Use Swipe over Rake or Moonfire at 6 targets.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/swipe_cat,if=spell_targets.swipe_cat>=6
# Refresh Rake early with Bloodtalons
actions.generator+=/pool_resource,for_next=1
actions.generator+=/rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
actions.generator+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
# Brutal Slash if you would cap out charges before the next adds spawn
actions.generator+=/brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
actions.generator+=/swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
actions.generator+=/shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

# Force use of Tiger's Fury before applying Rip.
actions.sbt_opener=tigers_fury,if=!dot.rip.ticking&combo_points=5

head=biornskin_hood,id=134196,bonus_id=3414/1527/3336
neck=strand_of_the_stars,id=137487,bonus_id=1727/1492/1813
shoulders=otherworldy_leather_mantle,id=139206,bonus_id=1807/1808/1472,gems=150mastery
back=nightborne_nobles_cloak,id=134290,bonus_id=3397/1808/1507/3337,gems=150mastery,enchant=150agi
chest=ekowraith_creator_of_worlds,id=137015,bonus_id=1811
wrists=waxsealed_leather_bracers,id=141429,bonus_id=3466/1472
hands=ravens_veil_gloves,id=139242,bonus_id=3411/1507/3336
waist=swordsingers_belt,id=134287,bonus_id=3413/43/1527/3337
legs=felbat_leather_leggings,id=134370,bonus_id=1727/1512/3336
feet=manatanned_sandals,id=141430,bonus_id=1487/3337
finger1=jeweled_signet_of_melandrus,id=134542,bonus_id=1727/1492/1813,enchant=150mastery
finger2=mindrend_band,id=138220,bonus_id=1807/1472,enchant=150mastery
trinket1=chrono_shard,id=137419,bonus_id=1727/41/1492/1813
trinket2=unstable_arcanocrystal,id=141482,bonus_id=1472
main_hand=fangs_of_ashamane,id=128860,bonus_id=723,gem_id=137370/133687/139249/0,relic_id=1727:1492:1813/1727:1497:3336/1807:1472/0
off_hand=fangs_of_ashamane,id=128859

# Gear Summary
# gear_ilvl=858.75
# gear_agility=13274
# gear_stamina=21087
# gear_crit_rating=5904
# gear_haste_rating=3638
# gear_mastery_rating=8400
# gear_versatility_rating=2279
# gear_leech_rating=404
# gear_armor=2125
# set_bonus=journey_through_time_2pc=1

Rothlandra

Rothlandra : 396698 dps, 235640 dps to main target

  • Race: Blood Elf
  • Class: Hunter
  • Spec: Marksmanship
  • Level: 110
  • Role: Attack
  • Position: ranged_back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
396698.0 396698.0 575.0 / 0.145% 109166.2 / 27.5% 23951.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
16.4 16.4 Focus 12.17% 36.2 100.0% 95%
Origin https://us.api.battle.net/wow/character/thrall/Rothlandra/advanced
Talents
  • 15: Lone Wolf (Marksmanship Hunter)
  • 30: Lock and Load (Marksmanship Hunter)
  • 45: Posthaste
  • 60: Patient Sniper (Marksmanship Hunter)
  • 75: Binding Shot
  • 90: Barrage
  • 100: Sidewinders (Marksmanship Hunter)
  • Talent Calculator
Artifact
Professions
  • mining: 229
  • herbalism: 238
Scale Factors for Rothlandra Damage Per Second
Mastery Agi Vers Crit Haste
Scale Factors 12.23 11.30 9.95 9.26 7.78
Normalized 1.08 1.00 0.88 0.82 0.69
Scale Deltas 1138 1138 1138 1138 1138
Error 0.72 0.73 0.72 0.72 0.72
Gear Ranking
Optimizers
Ranking
  • Mastery > Agi > Vers ~= Crit > Haste
Pawn string ( Pawn: v1: "Rothlandra": Agility=11.30, CritRating=9.26, HasteRating=7.78, MasteryRating=12.23, Versatility=9.95 )

Scale Factors for other metrics

Scale Factors for Rothlandra Damage Per Second
Mastery Agi Vers Crit Haste
Scale Factors 12.23 11.30 9.95 9.26 7.78
Normalized 1.08 1.00 0.88 0.82 0.69
Scale Deltas 1138 1138 1138 1138 1138
Error 0.72 0.73 0.72 0.72 0.72
Gear Ranking
Optimizers
Ranking
  • Mastery > Agi > Vers ~= Crit > Haste
Pawn string ( Pawn: v1: "Rothlandra": Agility=11.30, CritRating=9.26, HasteRating=7.78, MasteryRating=12.23, Versatility=9.95 )
Scale Factors for Rothlandra Priority Target Damage Per Second
Mastery Agi Haste Vers Crit
Scale Factors 7.57 6.60 6.32 5.92 5.50
Normalized 1.15 1.00 0.96 0.90 0.83
Scale Deltas 1138 1138 1138 1138 1138
Error 0.24 0.24 0.23 0.24 0.23
Gear Ranking
Optimizers
Ranking
  • Mastery > Agi > Haste > Vers > Crit
Pawn string ( Pawn: v1: "Rothlandra": Agility=6.60, CritRating=5.50, HasteRating=6.32, MasteryRating=7.57, Versatility=5.92 )
Scale Factors for Rothlandra Damage Per Second (Effective)
Mastery Agi Vers Crit Haste
Scale Factors 12.23 11.30 9.95 9.26 7.78
Normalized 1.08 1.00 0.88 0.82 0.69
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Mastery > Agi > Vers > Crit > Haste
Pawn string ( Pawn: v1: "Rothlandra": Agility=11.30, CritRating=9.26, HasteRating=7.78, MasteryRating=12.23, Versatility=9.95 )
Scale Factors for Rothlandra Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Rothlandra Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Rothlandra Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Rothlandra Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Rothlandra Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Rothlandra Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Rothlandra Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for RothlandraTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Rothlandra 396698
Aimed Shot 88361 (103715) 22.4% (26.3%) 104.8 3.81sec 396873 245674 Direct 104.7 220763 517320 338482 39.7%  

Stats details: aimed_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 104.77 104.66 0.00 0.00 1.6155 0.0000 35426145.35 52079789.33 31.98 245673.90 245673.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.12 60.30% 220763.42 97683 244207 220684.24 187391 241442 13933700 20483859 31.98
crit 41.55 39.70% 517319.50 205134 781462 517359.60 393725 602377 21492445 31595931 31.98
 
 

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
Spelldata
  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals ${$sw1*$<mult>} Physical damage.{$?s19434=true}[][ Replaces Cobra Shot.]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.04
 
    Legacy of the Windrunners 15354 3.9% 0.0 0.00sec 0 0 Direct 93.6 42945 100789 65765 39.5%  

Stats details: legacy_of_the_windrunners

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 93.57 0.00 0.00 0.0000 0.0000 6153670.26 9046478.18 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.66 60.55% 42945.19 19153 47884 42954.84 21069 47884 2433106 3576897 31.98
crit 36.91 39.45% 100789.16 40222 153228 100706.52 65361 139102 3720564 5469582 31.98
 
 

Action details: legacy_of_the_windrunners

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190852
  • name:Legacy of the Windrunners
  • school:physical
  • tooltip:
  • description:Aimed Shot has a chance to coalesce {$s1=6} extra Wind Arrows that also shoot your target.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.40
 
auto_shot 12781 3.2% 149.8 2.68sec 34178 12807 Direct 149.8 24454 52555 34178 34.6%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 149.77 149.77 0.00 0.00 2.6688 0.0000 5118942.79 7525330.78 31.98 12806.80 12806.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 97.94 65.39% 24453.72 24454 24454 24453.72 24454 24454 2395032 3520924 31.98
crit 51.83 34.61% 52554.75 48907 73361 52584.78 48907 58223 2723911 4004407 31.98
 
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Barrage 77744 19.6% 19.3 21.28sec 1596897 608418 Periodic 1033.4 21821 46188 29889 33.1% 11.4%

Stats details: barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.34 0.00 294.96 1033.40 2.6247 0.1556 30887559.33 45407637.97 31.98 608418.05 608418.05
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 691.2 66.89% 21821.01 17101 34203 21810.35 20675 23345 15083342 22173941 31.98
crit 342.2 33.11% 46188.37 34203 102608 46209.94 41022 51363 15804218 23233697 31.98
 
 

Action details: barrage

Static Values
  • id:120360
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.hunters_mark.down
Spelldata
  • id:120360
  • name:Barrage
  • school:physical
  • tooltip:
  • description:Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the target and an average of $<damageSec> Physical damage to each other enemy in front of you. Usable while moving.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: barrage_primary

Static Values
  • id:120361
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120361
  • name:Barrage
  • school:physical
  • tooltip:
  • description:{$@spelldesc120360=Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the target and an average of $<damageSec> Physical damage to each other enemy in front of you. Usable while moving.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.80
 
Deadly Grace 8368 2.1% 30.1 3.81sec 109766 0 Direct 30.0 79173 184705 110101 29.3%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.13 30.03 0.00 0.00 0.0000 0.0000 3306801.01 3306801.01 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.23 70.70% 79173.00 79173 79173 79173.00 79173 79173 1681106 1681106 0.00
crit 8.80 29.30% 184704.63 158346 237519 184662.80 158346 237519 1625695 1625695 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Marked Shot 110342 27.7% 33.9 11.85sec 1287244 1055449 Direct 108.3 299643 622729 403306 32.1%  

Stats details: marked_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.95 108.35 0.00 0.00 1.2196 0.0000 43697694.65 64239750.29 31.98 1055448.88 1055448.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.58 67.91% 299642.99 120778 301945 299645.55 271751 301945 22049111 32414282 31.98
crit 34.76 32.09% 622729.38 241556 905836 622886.64 524760 708915 21648583 31825468 31.98
 
 

Action details: marked_shot

Static Values
  • id:185901
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
Spelldata
  • id:185901
  • name:Marked Shot
  • school:physical
  • tooltip:
  • description:Rapidly fires shots at all targets with your Hunter's Mark, dealing $212621sw2 Physical damage and making them Vulnerable for {$187131d=30 seconds}. |Tinterface\icons\ability_hunter_mastermarksman.blp:24|t |cFFFFFFFFVulnerable|r {$@spelldesc187131=Damage taken from Marked Shot and Aimed Shot increased by {$s2=50}% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.50
 
Pepper Breath 3851 1.0% 18.5 21.40sec 83387 0 Periodic 90.9 16975 0 16975 0.0% 5.7%

Stats details: pepper_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.51 0.00 92.08 90.95 0.0000 0.2498 1543883.78 1543883.78 0.00 67125.38 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 90.9 100.00% 16975.23 68 16990 16975.92 16509 16990 1543884 1543884 0.00
 
 

Action details: pepper_breath

Static Values
  • id:225622
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225622
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Fires {$s1=4 to 6} fiery bolts, each dealing {$225624s1=16990} Fire damage.
 

Action details: pepper_breath_damage

Static Values
  • id:225624
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:17.5000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225624
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Deal {$s1=16990} Fire damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16990.00
  • base_dd_max:16990.00
 
Sidewinders 47382 11.9% 41.7 9.65sec 450001 366219 Direct 142.7 98320 203899 131549 31.5%  

Stats details: sidewinders

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.73 142.75 0.00 0.00 1.2288 0.0000 18778592.43 18778592.43 0.00 366218.62 366218.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 97.82 68.53% 98319.61 98320 98320 98319.61 98320 98320 9617799 9617799 0.00
crit 44.93 31.47% 203899.00 196639 294959 203915.84 196639 221921 9160793 9160793 0.00
 
 

Action details: sidewinders

Static Values
  • id:214579
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
Spelldata
  • id:214579
  • name:Sidewinders
  • school:nature
  • tooltip:
  • description:Launches Sidewinders that travel toward the target, weaving back and forth and dealing {$214581s1=0} Nature damage to each target they hit. Cannot hit the same target twice. Applies Vulnerable to all targets hit. |cFFFFFFFFGenerates {$s2=50} Focus.|r{$?s214579=false}[][ |cFFFFD200Also replaces Multi-Shot.|r]
 
Tormenting Cyclone 13413 3.4% 13.8 28.09sec 384934 0 Direct 326.2 12160 25275 16306 31.6%  

Stats details: tormenting_cyclone

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.82 326.17 0.00 0.00 0.0000 0.0000 5318353.98 5318353.98 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 223.07 68.39% 12160.00 12160 12160 12160.00 12160 12160 2712534 2712534 0.00
crit 103.10 31.61% 25274.76 24320 36480 25311.69 24320 30848 2605820 2605820 0.00
 
 

Action details: tormenting_cyclone

Static Values
  • id:221857
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221857
  • name:Tormenting Cyclone
  • school:shadow
  • tooltip:
  • description:{$@spelldesc221845=Your ranged attacks and spells have a chance to create a Tormenting Cyclone at the target's location for {$221857d=10 seconds} that deals {$s1=7995} Shadow damage every sec.}
 
Windburst 19101 4.8% 15.5 25.06sec 494644 358220 Direct 16.4 342026 704056 465536 34.1%  

Stats details: windburst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.48 16.44 0.00 0.00 1.3809 0.0000 7655523.22 11254344.28 31.98 358220.17 358220.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.83 65.88% 342026.47 342026 342026 342026.47 342026 342026 3705578 5447550 31.98
crit 5.61 34.12% 704055.99 684053 1026079 703679.97 0 1026079 3949946 5806794 31.93
 
 

Action details: windburst

Static Values
  • id:204147
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:204147
  • name:Windburst
  • school:physical
  • tooltip:
  • description:Focuses the power of Wind through |cFFFFCC99Thas'dorah|r, dealing $sw1 Physical damage to your target, and leaving behind a trail of wind for {$204475d=5 seconds} that increases the movement speed of allies by {$204477s1=50}%.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:8.00
 
Simple Action Stats Execute Interval
Rothlandra
Arcane Torrent 4.8 91.13sec

Stats details: arcane_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.84 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: arcane_torrent

Static Values
  • id:80483
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
Spelldata
  • id:80483
  • name:Arcane Torrent
  • school:arcane
  • tooltip:Silenced.
  • description:Silence all enemies within $A1 yards for {$d=2 seconds} and restore {$s2=15} of your Focus. Non-player victim spellcasting is also interrupted for {$32747d=3 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rothlandra
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rothlandra
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Trueshot 2.9 173.67sec

Stats details: trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.88 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: trueshot

Static Values
  • id:193526
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:160.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16
Spelldata
  • id:193526
  • name:Trueshot
  • school:physical
  • tooltip:Haste increased by {$s1=40}% and Arcane Shot and Multi-Shot apply Hunter's Mark.
  • description:Increases haste by {$s1=40}% and causes Arcane Shot and Multi-Shot to always apply Hunter's Mark. Lasts {$d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.12% 22.95% 0.0(0.0) 1.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bullseye 6.9 279.8 46.6sec 1.2sec 29.17% 29.17% 167.5(167.5) 5.9

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_bullseye
  • max_stacks:30
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01

Stack Uptimes

  • bullseye_1:0.17%
  • bullseye_2:0.18%
  • bullseye_3:0.16%
  • bullseye_4:0.15%
  • bullseye_5:4.29%
  • bullseye_6:0.13%
  • bullseye_7:0.13%
  • bullseye_8:0.12%
  • bullseye_9:0.12%
  • bullseye_10:2.34%
  • bullseye_11:0.11%
  • bullseye_12:0.11%
  • bullseye_13:0.11%
  • bullseye_14:0.10%
  • bullseye_15:0.39%
  • bullseye_16:0.10%
  • bullseye_17:0.09%
  • bullseye_18:0.10%
  • bullseye_19:0.10%
  • bullseye_20:0.40%
  • bullseye_21:0.11%
  • bullseye_22:0.11%
  • bullseye_23:0.11%
  • bullseye_24:0.11%
  • bullseye_25:0.43%
  • bullseye_26:0.12%
  • bullseye_27:0.12%
  • bullseye_28:0.12%
  • bullseye_29:0.12%
  • bullseye_30:18.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:204090
  • name:Bullseye
  • tooltip:Critical strike chance increased by {$s1=1}%.
  • description:{$@spelldesc204089=When your abilities damage a target below {$s1=20}% health, you gain {$204090s1=1}% increased critical strike chance for {$204090d=6 seconds}, stacking up to {$204090u=30} times.}
  • max_stacks:30
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Lock and Load 11.4 0.5 33.1sec 31.5sec 8.71% 10.77% 0.5(0.7) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_lock_and_load
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lock_and_load_1:4.60%
  • lock_and_load_2:4.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:$@spelldesc198811
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Marking Targets 33.1 12.4 12.2sec 8.8sec 41.19% 49.74% 12.4(12.4) 0.1

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_marking_targets
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • marking_targets_1:41.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:223138
  • name:Marking Targets
  • tooltip:Next {$?s214579=false}[Sidewinders][Arcane Shot or Multi-Shot] will apply Hunter's Mark.
  • description:Your next {$?s214579=false}[Sidewinders][Arcane Shot or Multi-Shot] will apply Hunter's Mark. Hunter's Mark activates Marked Shot.
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 79.8sec 0.0sec 14.68% 14.68% 0.0(0.0) 2.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:14.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 14.53% 14.53% 2.0(2.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.53%

Trigger Attempt Success

  • trigger_pct:100.00%
Rapid Killing 2.9 0.0 170.2sec 173.8sec 10.65% 10.89% 0.0(0.0) 2.8

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_rapid_killing
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • rapid_killing_1:10.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:191342
  • name:Rapid Killing
  • tooltip:Critical damage increased by {$s1=50}%.
  • description:{$@spelldesc191339=Trueshot also increases your critical strike damage by {$191342s1=50}% for its duration.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Trueshot 2.9 0.0 170.2sec 173.8sec 10.65% 15.54% 0.0(0.0) 2.8

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_trueshot
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40

Stack Uptimes

  • trueshot_1:10.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193526
  • name:Trueshot
  • tooltip:Haste increased by {$s1=40}% and Arcane Shot and Multi-Shot apply Hunter's Mark.
  • description:Increases haste by {$s1=40}% and causes Arcane Shot and Multi-Shot to always apply Hunter's Mark. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Rothlandra
aimed_shot Focus 104.8 4083.4 39.0 39.0 10182.7
barrage Focus 19.3 1160.5 60.0 60.0 26615.1
marked_shot Focus 33.9 1018.4 30.0 30.0 42908.1
windburst Focus 16.5 329.5 20.0 21.3 23231.3
Resource Gains Type Count Total Average Overflow
arcane_torrent Focus 4.84 71.79 (1.10%) 14.84 0.78 1.07%
sidewinders Focus 41.73 1947.22 (29.86%) 46.66 139.28 6.68%
focus_regen Focus 1460.64 4501.14 (69.03%) 3.08 385.12 7.88%
Resource RPS-Gain RPS-Loss
Focus 16.26 16.44
Combat End Resource Mean Min Max
Focus 78.63 0.03 150.00

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 6.6%

Procs

Count Interval
starved: barrage 93.1 5.5sec
lock_and_load 12.0 31.5sec
no_vuln_aimed_shot 12.3 26.2sec
no_vuln_marked_shot 5.5 60.5sec
marking_targets 45.5 8.8sec
wasted_marking_targets 12.4 30.2sec

Statistics & Data Analysis

Fight Length
Sample Data Rothlandra Fight Length
Count 9999
Mean 401.00
Minimum 308.02
Maximum 501.87
Spread ( max - min ) 193.85
Range [ ( max - min ) / 2 * 100% ] 24.17%
DPS
Sample Data Rothlandra Damage Per Second
Count 9999
Mean 396698.02
Minimum 316825.75
Maximum 500227.32
Spread ( max - min ) 183401.57
Range [ ( max - min ) / 2 * 100% ] 23.12%
Standard Deviation 29338.2695
5th Percentile 352933.71
95th Percentile 448533.49
( 95th Percentile - 5th Percentile ) 95599.78
Mean Distribution
Standard Deviation 293.3974
95.00% Confidence Intervall ( 396122.97 - 397273.07 )
Normalized 95.00% Confidence Intervall ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 210
0.1% Error 21010
0.1 Scale Factor Error with Delta=300 7347720
0.05 Scale Factor Error with Delta=300 29390883
0.01 Scale Factor Error with Delta=300 734772095
Priority Target DPS
Sample Data Rothlandra Priority Target Damage Per Second
Count 9999
Mean 235640.26
Minimum 204751.00
Maximum 274273.40
Spread ( max - min ) 69522.40
Range [ ( max - min ) / 2 * 100% ] 14.75%
Standard Deviation 9495.9472
5th Percentile 220375.50
95th Percentile 251807.77
( 95th Percentile - 5th Percentile ) 31432.27
Mean Distribution
Standard Deviation 94.9642
95.00% Confidence Intervall ( 235454.13 - 235826.38 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 62
0.1% Error 6238
0.1 Scale Factor Error with Delta=300 769768
0.05 Scale Factor Error with Delta=300 3079074
0.01 Scale Factor Error with Delta=300 76976871
DPS(e)
Sample Data Rothlandra Damage Per Second (Effective)
Count 9999
Mean 396698.02
Minimum 316825.75
Maximum 500227.32
Spread ( max - min ) 183401.57
Range [ ( max - min ) / 2 * 100% ] 23.12%
Damage
Sample Data Rothlandra Damage
Count 9999
Mean 157887166.81
Minimum 123749362.78
Maximum 193442692.36
Spread ( max - min ) 69693329.58
Range [ ( max - min ) / 2 * 100% ] 22.07%
DTPS
Sample Data Rothlandra Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Rothlandra Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Rothlandra Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Rothlandra Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Rothlandra Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Rothlandra Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data RothlandraTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Rothlandra Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=fishbrul_special
2 0.00 summon_pet
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
5 0.00 augmentation,type=defiled
6 0.00 windburst
Default action list Executed every time the actor is available.
# count action,conditions
7 0.98 auto_shot
8 4.84 arcane_torrent,if=focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
0.00 blood_fury
0.00 berserking
9 0.02 auto_shot
0.00 variable,name=vulnerable_time,value=debuff.vulnerability.remains
A 0.00 call_action_list,name=open,if=time<=15&talent.sidewinders.enabled&active_enemies=1
B 0.00 call_action_list,name=cooldowns
0.00 a_murder_of_crows,if=debuff.hunters_mark.down
C 0.00 call_action_list,name=trueshotaoe,if=active_enemies>1&!talent.sidewinders.enabled&buff.trueshot.up
D 11.98 barrage,if=debuff.hunters_mark.down
0.00 black_arrow,if=debuff.hunters_mark.down
0.00 a_murder_of_crows,if=(target.health.pct>30|target.health.pct<=20)&variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>60&focus+(focus.regen*debuff.hunters_mark.remains)>=60
E 6.43 barrage,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>90&focus+(focus.regen*debuff.hunters_mark.remains)>=90
0.00 black_arrow,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>70&focus+(focus.regen*debuff.hunters_mark.remains)>=70
0.00 piercing_shot,if=!talent.patient_sniper.enabled&focus>50
F 17.48 windburst,if=(!talent.patient_sniper.enabled|talent.sidewinders.enabled)&(debuff.hunters_mark.down|debuff.hunters_mark.remains>execute_time&focus+(focus.regen*debuff.hunters_mark.remains)>50)
G 0.02 windburst,if=talent.patient_sniper.enabled&!talent.sidewinders.enabled&((debuff.vulnerability.down|debuff.vulnerability.remains<2)|(debuff.hunters_mark.up&buff.marking_targets.up&debuff.vulnerability.down))
H 0.00 call_action_list,name=targetdie,if=target.time_to_die<6&active_enemies=1
I 10.07 sidewinders,if=(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
0.00 sentinel,if=debuff.hunters_mark.down&(buff.marking_targets.down|buff.trueshot.up)
J 0.45 marked_shot,target=2,if=!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
0.00 arcane_shot,if=!talent.patient_sniper.enabled&spell_targets.barrage=1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
0.00 multishot,if=!talent.patient_sniper.enabled&spell_targets.barrage>1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
0.00 arcane_shot,if=talent.steady_focus.enabled&spell_targets.barrage=1&(buff.steady_focus.down|buff.steady_focus.remains<2)
0.00 multishot,if=talent.steady_focus.enabled&spell_targets.barrage>1&(buff.steady_focus.down|buff.steady_focus.remains<2)
0.00 explosive_shot
K 19.55 marked_shot,if=!talent.patient_sniper.enabled|(talent.barrage.enabled&spell_targets.barrage>2)
L 30.37 aimed_shot,if=debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
M 69.32 aimed_shot,if=debuff.hunters_mark.down&debuff.vulnerability.remains>execute_time&(talent.sidewinders.enabled|buff.marking_targets.down|(debuff.hunters_mark.remains>execute_time+gcd&focus+5+focus.regen*debuff.hunters_mark.remains>80))
N 9.36 marked_shot,if=debuff.hunters_mark.remains<1|variable.vulnerable_time<1|spell_targets.barrage>1|buff.trueshot.up
O 0.98 marked_shot,if=buff.marking_targets.up&(!talent.sidewinders.enabled|cooldown.sidewinders.charges_fractional>=1.2)
P 28.22 sidewinders,if=buff.marking_targets.up&debuff.hunters_mark.down&(focus<=80|(variable.vulnerable_time<2&cooldown.windburst.remains>3&cooldown.sidewinders.charges_fractional>=1.2))
0.00 piercing_shot,if=talent.patient_sniper.enabled&focus>80
0.00 arcane_shot,if=spell_targets.barrage=1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
0.00 multishot,if=spell_targets.barrage>1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
Q 10.08 aimed_shot,if=debuff.vulnerability.down&focus>80&cooldown.windburst.remains>3
0.00 multishot,if=spell_targets.barrage>2
actions.cooldowns
# count action,conditions
R 1.00 potion,name=deadly_grace,if=(buff.trueshot.react&buff.bloodlust.react)|buff.bullseye.react>=23|target.time_to_die<31
S 1.93 /trueshot,if=buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16
actions.open
# count action,conditions
0.00 a_murder_of_crows
T 0.95 trueshot
U 1.34 sidewinders,if=(buff.marking_targets.down&buff.trueshot.remains<2)|(charges_fractional>=1.9&focus<80)
V 2.90 marked_shot
W 1.20 aimed_shot,if=buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
0.00 black_arrow
X 0.93 barrage
Y 6.75 aimed_shot,if=execute_time<debuff.vulnerability.remains
Z 1.48 sidewinders
a 0.29 aimed_shot
0.00 arcane_shot
actions.targetdie
# count action,conditions
b 0.71 marked_shot
c 0.01 windburst
d 1.18 aimed_shot,if=execute_time<debuff.vulnerability.remains
e 0.63 sidewinders
f 0.23 aimed_shot
0.00 arcane_shot

Sample Sequence

04567TXYUVY8YYYUVYZVaYLIMDPKFMMPKMMMQQPELNFMMPKMMQPEKMFMMMPLKMMPEKMMFMMM8QLIMDLPKIKFMMMPDMMQRQQPFLLLKDPKMMPKMFMSMLDINLMMQQPKMFMMD8PNMMPLLLNPEFKMMPKMMQQQPDIFMMMQPKMDQIFLLLKIMMDPKM8MFMMPLEKMPKMMFMMMPELNMIMMFMMPESNMMMILLLNFMMMMMPEMNMPLLKFM8PLENMIMMQMFMeEf

Sample Sequence Table

time name target resources buffs
Pre flask Rothlandra 150.0/150: 100% focus
Pre potion Fluffy_Pillow 150.0/150: 100% focus potion_of_deadly_grace
Pre augmentation Rothlandra 150.0/150: 100% focus potion_of_deadly_grace
0:00.000 windburst Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 start_auto_shot Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 trueshot Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 barrage Fluffy_Pillow 130.0/150: 87% focus rapid_killing, trueshot, potion_of_deadly_grace
0:02.100 aimed_shot Fluffy_Pillow 109.1/150: 73% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:03.073 sidewinders Fluffy_Pillow 79.2/150: 53% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:03.828 marked_shot Fluffy_Pillow 144.7/150: 96% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:04.582 aimed_shot Fluffy_Pillow 130.3/150: 87% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:05.556 arcane_torrent Fluffy_Pillow 100.1/150: 67% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:05.556 aimed_shot Fluffy_Pillow 115.1/150: 77% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:06.531 aimed_shot Fluffy_Pillow 85.2/150: 57% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:07.507 aimed_shot Fluffy_Pillow 55.3/150: 37% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:08.481 sidewinders Fluffy_Pillow 25.4/150: 17% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:09.236 marked_shot Fluffy_Pillow 91.0/150: 61% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:09.991 aimed_shot Fluffy_Pillow 76.5/150: 51% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:10.966 sidewinders Fluffy_Pillow 46.6/150: 31% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:11.720 marked_shot Fluffy_Pillow 112.2/150: 75% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:12.476 Waiting 0.700 sec 97.8/150: 65% focus bloodlust, raid_movement, rapid_killing, trueshot, potion_of_deadly_grace
0:13.176 aimed_shot Fluffy_Pillow 112.2/150: 75% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:14.151 aimed_shot Fluffy_Pillow 82.3/150: 55% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:15.127 Waiting 0.100 sec 51.7/150: 34% focus bloodlust, potion_of_deadly_grace
0:15.227 aimed_shot Fluffy_Pillow 53.1/150: 35% focus bloodlust, potion_of_deadly_grace
0:16.590 Waiting 0.900 sec 23.2/150: 15% focus bloodlust, potion_of_deadly_grace
0:17.490 sidewinders Fluffy_Pillow 36.5/150: 24% focus bloodlust, potion_of_deadly_grace
0:18.511 aimed_shot Fluffy_Pillow 101.5/150: 68% focus bloodlust, potion_of_deadly_grace
0:19.872 barrage Fluffy_Pillow 71.6/150: 48% focus bloodlust, marking_targets, potion_of_deadly_grace
0:22.186 sidewinders Fluffy_Pillow 45.6/150: 30% focus bloodlust, raid_movement, marking_targets, potion_of_deadly_grace
0:23.208 marked_shot Fluffy_Pillow 110.7/150: 74% focus bloodlust, raid_movement, marking_targets, potion_of_deadly_grace
0:24.230 windburst Fluffy_Pillow 95.7/150: 64% focus bloodlust, marking_targets, potion_of_deadly_grace
0:25.255 aimed_shot Fluffy_Pillow 90.8/150: 61% focus bloodlust, marking_targets, potion_of_deadly_grace
0:26.618 aimed_shot Fluffy_Pillow 60.9/150: 41% focus bloodlust, marking_targets, potion_of_deadly_grace
0:27.981 Waiting 0.600 sec 31.0/150: 21% focus bloodlust, marking_targets, potion_of_deadly_grace
0:28.581 sidewinders Fluffy_Pillow 39.8/150: 27% focus bloodlust, raid_movement, marking_targets
0:29.703 marked_shot Fluffy_Pillow 106.3/150: 71% focus bloodlust
0:30.727 aimed_shot Fluffy_Pillow 91.4/150: 61% focus bloodlust
0:32.089 aimed_shot Fluffy_Pillow 61.5/150: 41% focus bloodlust
0:33.452 aimed_shot Fluffy_Pillow 81.5/150: 54% focus bloodlust, lock_and_load
0:34.474 Waiting 1.300 sec 96.6/150: 64% focus bloodlust
0:35.774 aimed_shot Fluffy_Pillow 115.7/150: 77% focus bloodlust
0:37.138 aimed_shot Fluffy_Pillow 85.8/150: 57% focus bloodlust
0:38.499 Waiting 0.400 sec 55.9/150: 37% focus bloodlust
0:38.899 sidewinders Fluffy_Pillow 61.8/150: 41% focus bloodlust, marking_targets
0:39.921 barrage Fluffy_Pillow 126.8/150: 85% focus bloodlust, bullseye(5)
0:42.294 aimed_shot Fluffy_Pillow 97.2/150: 65% focus bullseye(5)
0:44.005 marked_shot Fluffy_Pillow 116.6/150: 78% focus raid_movement, bullseye(5)
0:45.332 windburst Fluffy_Pillow 101.6/150: 68% focus
0:46.660 aimed_shot Fluffy_Pillow 96.6/150: 64% focus marking_targets
0:48.430 aimed_shot Fluffy_Pillow 66.7/150: 44% focus marking_targets
0:50.003 Waiting 0.800 sec 84.5/150: 56% focus raid_movement, marking_targets
0:50.803 sidewinders Fluffy_Pillow 93.6/150: 62% focus raid_movement, marking_targets
0:52.132 marked_shot Fluffy_Pillow 150.0/150: 100% focus raid_movement, marking_targets
0:53.460 Waiting 0.200 sec 135.0/150: 90% focus raid_movement, marking_targets
0:53.660 aimed_shot Fluffy_Pillow 137.3/150: 92% focus marking_targets
0:55.432 aimed_shot Fluffy_Pillow 150.0/150: 100% focus lock_and_load, marking_targets
0:56.761 Waiting 1.400 sec 150.0/150: 100% focus marking_targets
0:58.161 aimed_shot Fluffy_Pillow 150.0/150: 100% focus lock_and_load(2), marking_targets
0:59.490 sidewinders Fluffy_Pillow 150.0/150: 100% focus lock_and_load, marking_targets
1:00.820 barrage Fluffy_Pillow 150.0/150: 100% focus raid_movement, lock_and_load, marking_targets
1:03.766 marked_shot Fluffy_Pillow 123.4/150: 82% focus lock_and_load, marking_targets
1:05.094 aimed_shot Fluffy_Pillow 108.4/150: 72% focus lock_and_load, marking_targets
1:06.423 windburst Fluffy_Pillow 123.5/150: 82% focus marking_targets
1:07.984 Waiting 0.100 sec 121.2/150: 81% focus marking_targets
1:08.084 aimed_shot Fluffy_Pillow 122.3/150: 82% focus marking_targets
1:09.854 aimed_shot Fluffy_Pillow 92.3/150: 62% focus marking_targets
1:11.625 aimed_shot Fluffy_Pillow 62.4/150: 42% focus marking_targets
1:13.396 sidewinders Fluffy_Pillow 32.5/150: 22% focus marking_targets
1:14.725 aimed_shot Fluffy_Pillow 97.5/150: 65% focus lock_and_load(2), marking_targets
1:16.053 Waiting 0.300 sec 112.6/150: 75% focus raid_movement, lock_and_load, marking_targets
1:16.353 marked_shot Fluffy_Pillow 116.0/150: 77% focus raid_movement, lock_and_load, marking_targets
1:17.680 aimed_shot Fluffy_Pillow 101.0/150: 67% focus lock_and_load, marking_targets
1:19.008 aimed_shot Fluffy_Pillow 116.0/150: 77% focus marking_targets
1:20.335 Waiting 0.100 sec 131.1/150: 87% focus raid_movement, marking_targets
1:20.435 sidewinders Fluffy_Pillow 132.2/150: 88% focus raid_movement, marking_targets
1:21.764 barrage Fluffy_Pillow 150.0/150: 100% focus raid_movement
1:24.780 marked_shot Fluffy_Pillow 124.2/150: 83% focus
1:26.108 aimed_shot Fluffy_Pillow 109.2/150: 73% focus lock_and_load(2)
1:27.437 aimed_shot Fluffy_Pillow 124.3/150: 83% focus lock_and_load
1:28.766 windburst Fluffy_Pillow 139.3/150: 93% focus
1:30.096 aimed_shot Fluffy_Pillow 130.1/150: 87% focus
1:31.865 aimed_shot Fluffy_Pillow 100.0/150: 67% focus
1:33.193 aimed_shot Fluffy_Pillow 115.1/150: 77% focus
1:34.963 Waiting 0.500 sec 85.1/150: 57% focus
1:35.463 arcane_torrent Fluffy_Pillow 90.8/150: 61% focus
1:35.556 Waiting 0.100 sec 106.9/150: 71% focus
1:35.656 aimed_shot Fluffy_Pillow 108.0/150: 72% focus
1:37.426 aimed_shot Fluffy_Pillow 78.0/150: 52% focus
1:39.198 sidewinders Fluffy_Pillow 48.1/150: 32% focus
1:40.527 aimed_shot Fluffy_Pillow 113.2/150: 75% focus bullseye(5)
1:42.296 barrage Fluffy_Pillow 83.2/150: 55% focus bullseye(5), marking_targets
1:45.100 aimed_shot Fluffy_Pillow 55.0/150: 37% focus bullseye(5), marking_targets
1:46.869 sidewinders Fluffy_Pillow 25.0/150: 17% focus marking_targets
1:48.198 Waiting 0.700 sec 90.1/150: 60% focus raid_movement, marking_targets
1:48.898 marked_shot Fluffy_Pillow 98.0/150: 65% focus raid_movement, marking_targets
1:50.226 Waiting 0.600 sec 83.1/150: 55% focus raid_movement, marking_targets
1:50.826 sidewinders Fluffy_Pillow 89.8/150: 60% focus raid_movement, marking_targets
1:52.154 marked_shot Fluffy_Pillow 150.0/150: 100% focus raid_movement
1:53.481 Waiting 0.100 sec 135.0/150: 90% focus raid_movement
1:53.581 windburst Fluffy_Pillow 136.2/150: 91% focus
1:54.910 aimed_shot Fluffy_Pillow 130.1/150: 87% focus
1:56.682 aimed_shot Fluffy_Pillow 100.1/150: 67% focus
1:58.452 aimed_shot Fluffy_Pillow 70.1/150: 47% focus
2:00.223 Waiting 1.100 sec 40.2/150: 27% focus
2:01.323 sidewinders Fluffy_Pillow 52.7/150: 35% focus
2:02.651 barrage Fluffy_Pillow 117.7/150: 78% focus lock_and_load(2)
2:05.421 aimed_shot Fluffy_Pillow 89.1/150: 59% focus lock_and_load(2)
2:06.750 Waiting 0.500 sec 104.1/150: 69% focus lock_and_load(2), marking_targets
2:07.250 aimed_shot Fluffy_Pillow 109.8/150: 73% focus lock_and_load(2), marking_targets
2:08.577 aimed_shot Fluffy_Pillow 124.8/150: 83% focus lock_and_load, marking_targets
2:09.906 potion Fluffy_Pillow 139.9/150: 93% focus marking_targets
2:09.906 aimed_shot Fluffy_Pillow 139.9/150: 93% focus marking_targets, potion_of_deadly_grace
2:11.676 aimed_shot Fluffy_Pillow 100.1/150: 67% focus marking_targets, potion_of_deadly_grace
2:13.444 sidewinders Fluffy_Pillow 70.1/150: 47% focus marking_targets, potion_of_deadly_grace
2:14.773 windburst Fluffy_Pillow 135.1/150: 90% focus potion_of_deadly_grace
2:16.233 aimed_shot Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
2:18.002 aimed_shot Fluffy_Pillow 100.0/150: 67% focus potion_of_deadly_grace
2:19.771 aimed_shot Fluffy_Pillow 70.1/150: 47% focus potion_of_deadly_grace
2:21.101 marked_shot Fluffy_Pillow 85.2/150: 57% focus potion_of_deadly_grace
2:22.428 barrage Fluffy_Pillow 70.2/150: 47% focus potion_of_deadly_grace
2:25.590 Waiting 0.300 sec 46.0/150: 31% focus potion_of_deadly_grace
2:25.890 sidewinders Fluffy_Pillow 49.4/150: 33% focus marking_targets, potion_of_deadly_grace
2:27.219 marked_shot Fluffy_Pillow 114.5/150: 76% focus potion_of_deadly_grace
2:28.548 aimed_shot Fluffy_Pillow 99.5/150: 66% focus potion_of_deadly_grace
2:30.319 aimed_shot Fluffy_Pillow 69.6/150: 46% focus potion_of_deadly_grace
2:32.089 sidewinders Fluffy_Pillow 39.6/150: 26% focus marking_targets, potion_of_deadly_grace
2:33.488 marked_shot Fluffy_Pillow 105.5/150: 70% focus potion_of_deadly_grace
2:34.816 aimed_shot Fluffy_Pillow 90.5/150: 60% focus marking_targets, potion_of_deadly_grace
2:36.146 Waiting 1.000 sec 105.6/150: 70% focus raid_movement, marking_targets, potion_of_deadly_grace
2:37.146 windburst Fluffy_Pillow 116.9/150: 78% focus marking_targets, potion_of_deadly_grace
2:38.474 aimed_shot Fluffy_Pillow 112.0/150: 75% focus marking_targets, potion_of_deadly_grace
2:40.244 trueshot Fluffy_Pillow 132.0/150: 88% focus lock_and_load, marking_targets
2:40.244 aimed_shot Fluffy_Pillow 132.0/150: 88% focus lock_and_load, marking_targets, rapid_killing, trueshot
2:41.193 Waiting 0.100 sec 147.1/150: 98% focus marking_targets, rapid_killing, trueshot
2:41.293 aimed_shot Fluffy_Pillow 148.7/150: 99% focus marking_targets, rapid_killing, trueshot
2:42.558 barrage Fluffy_Pillow 100.1/150: 67% focus marking_targets, rapid_killing, trueshot
2:44.863 sidewinders Fluffy_Pillow 76.6/150: 51% focus marking_targets, rapid_killing, trueshot
2:45.811 marked_shot Fluffy_Pillow 141.7/150: 94% focus marking_targets, rapid_killing, trueshot
2:46.762 aimed_shot Fluffy_Pillow 126.7/150: 84% focus marking_targets, rapid_killing, trueshot
2:48.028 aimed_shot Fluffy_Pillow 96.8/150: 65% focus marking_targets, rapid_killing, trueshot
2:49.295 aimed_shot Fluffy_Pillow 66.9/150: 45% focus marking_targets, rapid_killing, trueshot
2:50.244 Waiting 2.400 sec 82.0/150: 55% focus raid_movement, marking_targets, rapid_killing, trueshot
2:52.644 aimed_shot Fluffy_Pillow 120.0/150: 80% focus marking_targets, rapid_killing, trueshot
2:53.909 aimed_shot Fluffy_Pillow 90.1/150: 60% focus marking_targets, rapid_killing, trueshot
2:55.174 sidewinders Fluffy_Pillow 110.2/150: 73% focus lock_and_load, marking_targets, rapid_killing, trueshot
2:56.123 marked_shot Fluffy_Pillow 150.0/150: 100% focus lock_and_load
2:57.449 aimed_shot Fluffy_Pillow 135.0/150: 90% focus lock_and_load
2:58.777 windburst Fluffy_Pillow 150.0/150: 100% focus
3:00.104 aimed_shot Fluffy_Pillow 130.0/150: 87% focus
3:01.873 aimed_shot Fluffy_Pillow 100.0/150: 67% focus
3:03.642 barrage Fluffy_Pillow 70.1/150: 47% focus
3:06.483 arcane_torrent Fluffy_Pillow 42.3/150: 28% focus bullseye(10)
3:06.483 Waiting 0.400 sec 57.3/150: 38% focus bullseye(10)
3:06.883 sidewinders Fluffy_Pillow 61.8/150: 41% focus bullseye(10), marking_targets
3:08.211 marked_shot Fluffy_Pillow 126.8/150: 85% focus raid_movement, bullseye(15)
3:09.539 aimed_shot Fluffy_Pillow 111.9/150: 75% focus bullseye(20)
3:11.307 aimed_shot Fluffy_Pillow 81.9/150: 55% focus bullseye(20)
3:13.076 sidewinders Fluffy_Pillow 52.0/150: 35% focus bullseye(20), marking_targets
3:14.405 aimed_shot Fluffy_Pillow 117.0/150: 78% focus
3:16.174 aimed_shot Fluffy_Pillow 137.1/150: 91% focus lock_and_load
3:17.502 Waiting 0.100 sec 150.0/150: 100% focus
3:17.602 aimed_shot Fluffy_Pillow 150.0/150: 100% focus
3:19.372 marked_shot Fluffy_Pillow 100.1/150: 67% focus
3:20.700 Waiting 2.000 sec 85.1/150: 57% focus raid_movement
3:22.700 sidewinders Fluffy_Pillow 107.8/150: 72% focus raid_movement, marking_targets
3:24.028 barrage Fluffy_Pillow 150.0/150: 100% focus raid_movement
3:26.866 windburst Fluffy_Pillow 122.2/150: 81% focus
3:28.195 marked_shot Fluffy_Pillow 117.2/150: 78% focus
3:29.523 aimed_shot Fluffy_Pillow 102.3/150: 68% focus
3:31.295 aimed_shot Fluffy_Pillow 122.3/150: 82% focus lock_and_load
3:32.622 sidewinders Fluffy_Pillow 137.4/150: 92% focus marking_targets
3:33.952 marked_shot Fluffy_Pillow 150.0/150: 100% focus
3:35.280 aimed_shot Fluffy_Pillow 135.0/150: 90% focus
3:37.047 aimed_shot Fluffy_Pillow 100.0/150: 67% focus
3:38.816 Waiting 0.700 sec 70.1/150: 47% focus
3:39.516 aimed_shot Fluffy_Pillow 78.0/150: 52% focus
3:40.845 Waiting 0.300 sec 93.0/150: 62% focus raid_movement
3:41.145 aimed_shot Fluffy_Pillow 96.4/150: 64% focus
3:42.914 Waiting 0.800 sec 66.5/150: 44% focus
3:43.714 aimed_shot Fluffy_Pillow 75.6/150: 50% focus
3:45.484 Waiting 0.300 sec 45.6/150: 30% focus
3:45.784 sidewinders Fluffy_Pillow 49.0/150: 33% focus
3:47.113 barrage Fluffy_Pillow 114.1/150: 76% focus
3:50.007 Waiting 0.700 sec 86.8/150: 58% focus raid_movement
3:50.707 sidewinders Fluffy_Pillow 94.8/150: 63% focus raid_movement
3:52.172 Waiting 1.500 sec 150.0/150: 100% focus raid_movement
3:53.672 windburst Fluffy_Pillow 150.0/150: 100% focus lock_and_load(2), marking_targets
3:55.000 aimed_shot Fluffy_Pillow 130.0/150: 87% focus lock_and_load(2), marking_targets
3:56.328 Waiting 0.900 sec 145.1/150: 97% focus raid_movement, lock_and_load, marking_targets
3:57.228 aimed_shot Fluffy_Pillow 150.0/150: 100% focus lock_and_load, marking_targets
3:58.556 aimed_shot Fluffy_Pillow 150.0/150: 100% focus marking_targets
4:00.325 Waiting 0.700 sec 100.0/150: 67% focus marking_targets
4:01.025 aimed_shot Fluffy_Pillow 108.0/150: 72% focus marking_targets
4:02.795 Waiting 0.100 sec 78.0/150: 52% focus marking_targets
4:02.895 sidewinders Fluffy_Pillow 79.2/150: 53% focus marking_targets
4:04.225 marked_shot Fluffy_Pillow 144.2/150: 96% focus
4:05.555 aimed_shot Fluffy_Pillow 129.3/150: 86% focus
4:07.324 barrage Fluffy_Pillow 99.3/150: 66% focus
4:10.304 Waiting 0.100 sec 73.1/150: 49% focus bullseye(30)
4:10.404 aimed_shot Fluffy_Pillow 74.2/150: 49% focus bullseye(30)
4:12.005 Waiting 1.700 sec 92.4/150: 62% focus raid_movement, bullseye(30)
4:13.705 sidewinders Fluffy_Pillow 111.6/150: 74% focus bullseye(30), marking_targets
4:15.034 windburst Fluffy_Pillow 150.0/150: 100% focus bullseye(30)
4:16.362 aimed_shot Fluffy_Pillow 130.0/150: 87% focus
4:18.132 aimed_shot Fluffy_Pillow 100.1/150: 67% focus
4:19.900 aimed_shot Fluffy_Pillow 70.1/150: 47% focus
4:21.228 marked_shot Fluffy_Pillow 85.1/150: 57% focus raid_movement
4:22.556 Waiting 0.300 sec 70.2/150: 47% focus raid_movement
4:22.856 sidewinders Fluffy_Pillow 73.6/150: 49% focus raid_movement
4:24.184 aimed_shot Fluffy_Pillow 138.6/150: 92% focus
4:25.953 aimed_shot Fluffy_Pillow 100.0/150: 67% focus
4:27.723 Waiting 0.100 sec 70.1/150: 47% focus
4:27.823 barrage Fluffy_Pillow 71.2/150: 47% focus
4:30.797 Waiting 2.200 sec 44.9/150: 30% focus
4:32.997 sidewinders Fluffy_Pillow 69.8/150: 47% focus marking_targets
4:34.539 marked_shot Fluffy_Pillow 137.3/150: 92% focus
4:35.870 aimed_shot Fluffy_Pillow 122.4/150: 82% focus
4:37.638 arcane_torrent Fluffy_Pillow 92.4/150: 62% focus marking_targets
4:37.638 aimed_shot Fluffy_Pillow 107.4/150: 72% focus marking_targets
4:39.408 Waiting 0.200 sec 77.5/150: 52% focus marking_targets
4:39.608 windburst Fluffy_Pillow 79.7/150: 53% focus marking_targets
4:40.937 aimed_shot Fluffy_Pillow 74.8/150: 50% focus marking_targets
4:42.708 Waiting 0.500 sec 44.9/150: 30% focus marking_targets
4:43.208 aimed_shot Fluffy_Pillow 50.5/150: 34% focus marking_targets
4:44.537 sidewinders Fluffy_Pillow 65.6/150: 44% focus raid_movement, marking_targets
4:45.866 aimed_shot Fluffy_Pillow 130.6/150: 87% focus
4:47.634 barrage Fluffy_Pillow 100.0/150: 67% focus
4:50.680 marked_shot Fluffy_Pillow 74.5/150: 50% focus raid_movement
4:52.009 Waiting 1.700 sec 59.6/150: 40% focus raid_movement
4:53.709 aimed_shot Fluffy_Pillow 78.9/150: 53% focus marking_targets
4:55.478 sidewinders Fluffy_Pillow 48.9/150: 33% focus marking_targets
4:56.807 marked_shot Fluffy_Pillow 114.0/150: 76% focus
4:58.136 aimed_shot Fluffy_Pillow 99.0/150: 66% focus
4:59.906 aimed_shot Fluffy_Pillow 69.1/150: 46% focus
5:01.235 windburst Fluffy_Pillow 84.1/150: 56% focus
5:02.565 aimed_shot Fluffy_Pillow 79.2/150: 53% focus marking_targets
5:04.334 aimed_shot Fluffy_Pillow 99.2/150: 66% focus lock_and_load, marking_targets
5:05.663 aimed_shot Fluffy_Pillow 114.3/150: 76% focus marking_targets
5:07.432 sidewinders Fluffy_Pillow 84.3/150: 56% focus marking_targets
5:08.761 barrage Fluffy_Pillow 149.4/150: 100% focus bullseye(5)
5:11.725 Waiting 0.100 sec 123.0/150: 82% focus bullseye(30)
5:11.825 aimed_shot Fluffy_Pillow 124.1/150: 83% focus bullseye(30)
5:13.593 marked_shot Fluffy_Pillow 94.1/150: 63% focus bullseye(30)
5:14.921 aimed_shot Fluffy_Pillow 79.2/150: 53% focus bullseye(30)
5:16.246 Waiting 0.300 sec 94.2/150: 63% focus raid_movement
5:16.546 sidewinders Fluffy_Pillow 97.6/150: 65% focus raid_movement
5:17.874 aimed_shot Fluffy_Pillow 150.0/150: 100% focus
5:19.644 aimed_shot Fluffy_Pillow 100.1/150: 67% focus
5:21.413 Waiting 0.900 sec 70.1/150: 47% focus
5:22.313 windburst Fluffy_Pillow 80.3/150: 54% focus
5:23.889 aimed_shot Fluffy_Pillow 78.1/150: 52% focus
5:25.659 Waiting 0.200 sec 48.2/150: 32% focus bullseye, marking_targets
5:25.859 aimed_shot Fluffy_Pillow 50.5/150: 34% focus bullseye, marking_targets
5:27.630 sidewinders Fluffy_Pillow 20.5/150: 14% focus bullseye(2), marking_targets
5:28.959 barrage Fluffy_Pillow 85.6/150: 57% focus bullseye(5), marking_targets
5:31.933 Waiting 0.400 sec 59.3/150: 40% focus bullseye(27), marking_targets
5:32.333 trueshot Fluffy_Pillow 63.8/150: 43% focus raid_movement, bullseye(28), marking_targets
5:32.333 marked_shot Fluffy_Pillow 63.8/150: 43% focus raid_movement, bullseye(28), marking_targets, rapid_killing, trueshot
5:33.283 Waiting 0.100 sec 48.9/150: 33% focus bullseye(29), marking_targets, rapid_killing, trueshot
5:33.383 aimed_shot Fluffy_Pillow 50.5/150: 34% focus bullseye(29), marking_targets, rapid_killing, trueshot
5:34.648 Waiting 0.200 sec 20.5/150: 14% focus bullseye(29), marking_targets, rapid_killing, trueshot
5:34.848 aimed_shot Fluffy_Pillow 23.7/150: 16% focus bullseye(30), lock_and_load(2), marking_targets, rapid_killing, trueshot
5:35.798 aimed_shot Fluffy_Pillow 38.8/150: 26% focus bullseye(30), lock_and_load, marking_targets, rapid_killing, trueshot
5:36.749 sidewinders Fluffy_Pillow 53.8/150: 36% focus bullseye(30), marking_targets, rapid_killing, trueshot
5:37.712 aimed_shot Fluffy_Pillow 119.1/150: 79% focus bullseye(30), rapid_killing, trueshot
5:38.978 aimed_shot Fluffy_Pillow 89.2/150: 59% focus bullseye(30), rapid_killing, trueshot
5:40.245 aimed_shot Fluffy_Pillow 59.3/150: 40% focus bullseye(30), rapid_killing, trueshot
5:41.511 Waiting 0.100 sec 29.4/150: 20% focus bullseye(30), rapid_killing, trueshot
5:41.611 marked_shot Fluffy_Pillow 31.0/150: 21% focus bullseye(30), rapid_killing, trueshot
5:42.559 Waiting 1.100 sec 16.0/150: 11% focus bullseye(30), marking_targets, rapid_killing, trueshot
5:43.659 windburst Fluffy_Pillow 33.4/150: 22% focus bullseye(30), marking_targets, rapid_killing, trueshot
5:44.833 aimed_shot Fluffy_Pillow 32.1/150: 21% focus bullseye(30), lock_and_load(2), marking_targets, rapid_killing, trueshot
5:45.783 aimed_shot Fluffy_Pillow 47.1/150: 31% focus bullseye(30), lock_and_load, marking_targets, rapid_killing, trueshot
5:46.730 aimed_shot Fluffy_Pillow 62.1/150: 41% focus bullseye(30), marking_targets, rapid_killing, trueshot
5:47.996 aimed_shot Fluffy_Pillow 29.2/150: 19% focus bullseye(30), lock_and_load(2), marking_targets
5:49.323 aimed_shot Fluffy_Pillow 44.3/150: 30% focus bullseye(30), lock_and_load, marking_targets
5:50.651 sidewinders Fluffy_Pillow 59.3/150: 40% focus bullseye(30), marking_targets
5:51.980 barrage Fluffy_Pillow 124.4/150: 83% focus bullseye(30)
5:54.911 Waiting 0.100 sec 97.6/150: 65% focus bullseye(30)
5:55.011 aimed_shot Fluffy_Pillow 98.7/150: 66% focus bullseye(30)
5:56.781 marked_shot Fluffy_Pillow 68.7/150: 46% focus bullseye(30), marking_targets
5:58.111 aimed_shot Fluffy_Pillow 53.8/150: 36% focus bullseye(30), marking_targets
5:59.883 sidewinders Fluffy_Pillow 23.9/150: 16% focus bullseye(30), marking_targets
6:01.211 aimed_shot Fluffy_Pillow 88.9/150: 59% focus bullseye(30), marking_targets
6:02.980 aimed_shot Fluffy_Pillow 59.0/150: 39% focus bullseye(30), marking_targets
6:04.308 marked_shot Fluffy_Pillow 74.0/150: 49% focus raid_movement, bullseye(30), marking_targets
6:05.635 windburst Fluffy_Pillow 59.0/150: 39% focus bullseye(30), marking_targets
6:06.962 aimed_shot Fluffy_Pillow 54.1/150: 36% focus bullseye(30), marking_targets
6:08.731 arcane_torrent Fluffy_Pillow 24.1/150: 16% focus bullseye(30), marking_targets
6:08.731 sidewinders Fluffy_Pillow 39.1/150: 26% focus bullseye(30), marking_targets
6:10.059 aimed_shot Fluffy_Pillow 104.2/150: 69% focus bullseye(30)
6:11.829 barrage Fluffy_Pillow 74.2/150: 49% focus bullseye(30)
6:14.836 marked_shot Fluffy_Pillow 48.3/150: 32% focus bullseye(30)
6:16.164 Waiting 1.500 sec 33.3/150: 22% focus bullseye(30)
6:17.664 aimed_shot Fluffy_Pillow 50.3/150: 34% focus bullseye(30)
6:19.434 sidewinders Fluffy_Pillow 20.4/150: 14% focus bullseye(30)
6:20.764 Waiting 0.400 sec 85.4/150: 57% focus raid_movement, bullseye(30), marking_targets
6:21.164 aimed_shot Fluffy_Pillow 90.0/150: 60% focus bullseye(30), marking_targets
6:22.933 aimed_shot Fluffy_Pillow 60.0/150: 40% focus bullseye(30), marking_targets
6:24.701 Waiting 0.500 sec 80.0/150: 53% focus bullseye(30), lock_and_load, marking_targets
6:25.201 aimed_shot Fluffy_Pillow 85.7/150: 57% focus bullseye(30), lock_and_load, marking_targets
6:26.530 aimed_shot Fluffy_Pillow 100.8/150: 67% focus bullseye(30), marking_targets
6:28.301 windburst Fluffy_Pillow 70.8/150: 47% focus bullseye(30), marking_targets
6:29.631 aimed_shot Fluffy_Pillow 65.9/150: 44% focus bullseye(30), marking_targets
6:31.400 sidewinders Fluffy_Pillow 35.9/150: 24% focus bullseye(30), marking_targets
6:32.727 barrage Fluffy_Pillow 101.0/150: 67% focus bullseye(30)
6:35.692 aimed_shot Fluffy_Pillow 74.5/150: 50% focus bullseye(30)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6228 6228 0
Agility 24908 23543 13391 (10777)
Stamina 30881 30881 19583
Intellect 6009 6009 0
Spirit 2 2 0
Health 1852860 1852860 0
Focus 150 150 0
Crit 28.25% 28.25% 4289
Haste 13.29% 13.29% 4318
Damage / Heal Versatility 0.00% 0.00% 0
Attack Power 24908 23543 0
Mastery 20.88% 20.88% 8894
Armor 2520 2520 2520
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 850.00
Local Head Greyed Dragonscale Coif
ilevel: 855, stats: { 341 Armor, +2038 Sta, +1359 AgiInt, +751 Mastery, +579 Crit }
Local Neck Nightborne's Jeweled Necklace
ilevel: 830, stats: { +908 Sta, +1217 Mastery, +487 Haste }
Local Shoulders Arcane Exterminator's Shoulderguards
ilevel: 830, stats: { 292 Armor, +807 AgiInt, +1211 Sta, +649 Crit, +259 Haste }
Local Chest Ley Dragoon's Hauberk
ilevel: 840, stats: { 401 Armor, +1182 AgiInt, +1773 Sta, +844 Mastery, +413 Haste }
Local Waist Belt of Mighty Links
ilevel: 865, stats: { 244 Armor, +1119 AgiInt, +1678 Sta, +673 Mastery, +362 Haste }
Local Legs Tempered Seaborne Leggings
ilevel: 850, stats: { 362 Armor, +1945 Sta, +1297 AgiInt, +820 Haste, +484 Crit }
Local Feet Frostburned Sabatons
ilevel: 860, stats: { 293 Armor, +1601 Sta, +1068 AgiInt, +617 Crit, +399 Haste }
Local Wrists Assorted Dragonscale Bracers
ilevel: 870, stats: { 193 Armor, +1319 Sta, +879 AgiInt, +548 Haste, +242 Mastery }
Local Hands Gauntlets of the Demented Mind
ilevel: 850, stats: { 259 Armor, +1459 Sta, +973 AgiInt, +574 Crit, +406 Mastery }, gems: { +150 Mastery }
Local Finger1 Signet of the Highborne Magi
ilevel: 840, stats: { +997 Sta, +1111 Mastery, +657 Crit }, gems: { +150 Mastery }, enchant: { +150 Mastery }
Local Finger2 Grasping Tentacle Loop
ilevel: 840, stats: { +997 Sta, +1011 Mastery, +758 Haste }, enchant: { +150 Mastery }
Local Trinket1 Nightborne's Hunting Horn
ilevel: 825, stats: { +977 Agi, +849 Mastery }
Local Trinket2 Twisting Wind
ilevel: 855, stats: { +1292 AgiInt }
Local Back Drape of the Raven Lord
ilevel: 860, stats: { 135 Armor, +801 StrAgiInt, +1201 Sta, +490 Mastery, +272 Haste }
Local Main Hand Thas'dorah, Legacy of the Windrunners
ilevel: 875, weapon: { 8823 - 8824, 3 }, stats: { +1637 Agi, +2456 Sta, +729 Crit, +700 Mastery }, relics: { +42 ilevels, +43 ilevels, +40 ilevels }

Talents

Level
15 Lone Wolf (Marksmanship Hunter) Steady Focus (Marksmanship Hunter) Careful Aim (Marksmanship Hunter)
30 Lock and Load (Marksmanship Hunter) Black Arrow (Marksmanship Hunter) True Aim (Marksmanship Hunter)
45 Posthaste Farstrider Trailblazer
60 Explosive Shot (Marksmanship Hunter) Sentinel (Marksmanship Hunter) Patient Sniper (Marksmanship Hunter)
75 Binding Shot Wyvern Sting Camouflage (Marksmanship Hunter)
90 A Murder of Crows Barrage Volley
100 Sidewinders (Marksmanship Hunter) Piercing Shot (Marksmanship Hunter) Trick Shot (Marksmanship Hunter)

Profile

hunter="Rothlandra"
origin="https://us.api.battle.net/wow/character/thrall/Rothlandra/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/85/161015381-avatar.jpg"
level=110
race=blood_elf
role=attack
position=ranged_back
professions=mining=229/herbalism=238
talents=1113121
artifact=55:0:0:0:0:307:1:308:1:310:1:312:3:313:3:315:3:319:3:320:3:321:1:322:1:1337:1
spec=marksmanship

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=fishbrul_special
actions.precombat+=/summon_pet
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/windburst

# Executed every time the actor is available.
actions=auto_shot
actions+=/arcane_torrent,if=focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
actions+=/blood_fury
actions+=/berserking
actions+=/auto_shot
actions+=/variable,name=vulnerable_time,value=debuff.vulnerability.remains
actions+=/call_action_list,name=open,if=time<=15&talent.sidewinders.enabled&active_enemies=1
actions+=/call_action_list,name=cooldowns
actions+=/a_murder_of_crows,if=debuff.hunters_mark.down
actions+=/call_action_list,name=trueshotaoe,if=active_enemies>1&!talent.sidewinders.enabled&buff.trueshot.up
actions+=/barrage,if=debuff.hunters_mark.down
actions+=/black_arrow,if=debuff.hunters_mark.down
actions+=/a_murder_of_crows,if=(target.health.pct>30|target.health.pct<=20)&variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>60&focus+(focus.regen*debuff.hunters_mark.remains)>=60
actions+=/barrage,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>90&focus+(focus.regen*debuff.hunters_mark.remains)>=90
actions+=/black_arrow,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>70&focus+(focus.regen*debuff.hunters_mark.remains)>=70
actions+=/piercing_shot,if=!talent.patient_sniper.enabled&focus>50
actions+=/windburst,if=(!talent.patient_sniper.enabled|talent.sidewinders.enabled)&(debuff.hunters_mark.down|debuff.hunters_mark.remains>execute_time&focus+(focus.regen*debuff.hunters_mark.remains)>50)
actions+=/windburst,if=talent.patient_sniper.enabled&!talent.sidewinders.enabled&((debuff.vulnerability.down|debuff.vulnerability.remains<2)|(debuff.hunters_mark.up&buff.marking_targets.up&debuff.vulnerability.down))
actions+=/call_action_list,name=targetdie,if=target.time_to_die<6&active_enemies=1
actions+=/sidewinders,if=(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
actions+=/sentinel,if=debuff.hunters_mark.down&(buff.marking_targets.down|buff.trueshot.up)
actions+=/marked_shot,target=2,if=!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
actions+=/arcane_shot,if=!talent.patient_sniper.enabled&spell_targets.barrage=1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
actions+=/multishot,if=!talent.patient_sniper.enabled&spell_targets.barrage>1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
actions+=/arcane_shot,if=talent.steady_focus.enabled&spell_targets.barrage=1&(buff.steady_focus.down|buff.steady_focus.remains<2)
actions+=/multishot,if=talent.steady_focus.enabled&spell_targets.barrage>1&(buff.steady_focus.down|buff.steady_focus.remains<2)
actions+=/explosive_shot
actions+=/marked_shot,if=!talent.patient_sniper.enabled|(talent.barrage.enabled&spell_targets.barrage>2)
actions+=/aimed_shot,if=debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
actions+=/aimed_shot,if=debuff.hunters_mark.down&debuff.vulnerability.remains>execute_time&(talent.sidewinders.enabled|buff.marking_targets.down|(debuff.hunters_mark.remains>execute_time+gcd&focus+5+focus.regen*debuff.hunters_mark.remains>80))
actions+=/marked_shot,if=debuff.hunters_mark.remains<1|variable.vulnerable_time<1|spell_targets.barrage>1|buff.trueshot.up
actions+=/marked_shot,if=buff.marking_targets.up&(!talent.sidewinders.enabled|cooldown.sidewinders.charges_fractional>=1.2)
actions+=/sidewinders,if=buff.marking_targets.up&debuff.hunters_mark.down&(focus<=80|(variable.vulnerable_time<2&cooldown.windburst.remains>3&cooldown.sidewinders.charges_fractional>=1.2))
actions+=/piercing_shot,if=talent.patient_sniper.enabled&focus>80
actions+=/arcane_shot,if=spell_targets.barrage=1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
actions+=/multishot,if=spell_targets.barrage>1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
actions+=/aimed_shot,if=debuff.vulnerability.down&focus>80&cooldown.windburst.remains>3
actions+=/multishot,if=spell_targets.barrage>2

actions.cooldowns=potion,name=deadly_grace,if=(buff.trueshot.react&buff.bloodlust.react)|buff.bullseye.react>=23|target.time_to_die<31
actions.cooldowns+=//trueshot,if=buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16

actions.open=a_murder_of_crows
actions.open+=/trueshot
actions.open+=/sidewinders,if=(buff.marking_targets.down&buff.trueshot.remains<2)|(charges_fractional>=1.9&focus<80)
actions.open+=/marked_shot
actions.open+=/aimed_shot,if=buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
actions.open+=/black_arrow
actions.open+=/barrage
actions.open+=/aimed_shot,if=execute_time<debuff.vulnerability.remains
actions.open+=/sidewinders
actions.open+=/aimed_shot
actions.open+=/arcane_shot

actions.targetdie=marked_shot
actions.targetdie+=/windburst
actions.targetdie+=/aimed_shot,if=execute_time<debuff.vulnerability.remains
actions.targetdie+=/sidewinders
actions.targetdie+=/aimed_shot
actions.targetdie+=/arcane_shot

actions.trueshotaoe=marked_shot
actions.trueshotaoe+=/piercing_shot
actions.trueshotaoe+=/barrage
actions.trueshotaoe+=/explosive_shot
actions.trueshotaoe+=/aimed_shot,if=active_enemies=2&buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
actions.trueshotaoe+=/multishot

head=greyed_dragonscale_coif,id=139214,bonus_id=1807/1477/3336
neck=nightbornes_jeweled_necklace,id=134275,bonus_id=3397/1492/1675
shoulders=arcane_exterminators_shoulderguards,id=134472,bonus_id=1482
back=drape_of_the_raven_lord,id=136770,bonus_id=1727/1512/3337
chest=ley_dragoons_hauberk,id=134302,bonus_id=3397/1502/3336
wrists=assorted_dragonscale_bracers,id=141433,bonus_id=3466/1482/3336
hands=gauntlets_of_the_demented_mind,id=138214,bonus_id=1807/1808/1472,gems=150mastery
waist=belt_of_mighty_links,id=137456,bonus_id=3413/1517/3337
legs=tempered_seaborne_leggings,id=133769,bonus_id=3410/1502/3336
feet=frostburned_sabatons,id=141432,bonus_id=1472
finger1=signet_of_the_highborne_magi,id=134537,bonus_id=1727/1808/1492/1813,gems=150mastery,enchant=150mastery
finger2=grasping_tentacle_loop,id=133634,bonus_id=1727/1492/1813,enchant=150mastery
trinket1=nightbornes_hunting_horn,id=134291,bonus_id=3396/605/1487/1675
trinket2=twisting_wind,id=139323,bonus_id=1807/1477/3336
main_hand=thasdorah_legacy_of_the_windrunners,id=128826,bonus_id=727,gem_id=137365/139260/136720/0,relic_id=1727:1497:3336/1807:1472/1727:1492:1813/0

# Gear Summary
# gear_ilvl=849.67
# gear_agility=13391
# gear_stamina=19583
# gear_crit_rating=4289
# gear_haste_rating=4318
# gear_mastery_rating=8894
# gear_armor=2520
summon_pet=cat

Sarkul

Sarkul : 444936 dps, 280294 dps to main target

  • Race: Orc
  • Class: Hunter
  • Spec: Marksmanship
  • Level: 110
  • Role: Attack
  • Position: ranged_back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
444936.4 444936.4 552.6 / 0.124% 109146.9 / 24.5% 27533.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
16.1 16.1 Focus 18.22% 35.2 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Sarkul/advanced
Talents
  • 15: Lone Wolf (Marksmanship Hunter)
  • 30: Lock and Load (Marksmanship Hunter)
  • 45: Posthaste
  • 60: Patient Sniper (Marksmanship Hunter)
  • 75: Binding Shot
  • 90: Volley
  • 100: Sidewinders (Marksmanship Hunter)
  • Talent Calculator
Artifact
Professions
  • leatherworking: 800
  • engineering: 707
Scale Factors for Sarkul Damage Per Second
Agi Haste Mastery Vers Crit
Scale Factors 13.59 12.39 11.98 11.04 10.67
Normalized 1.00 0.91 0.88 0.81 0.79
Scale Deltas 1138 1138 1138 1138 1138
Error 0.70 0.70 0.70 0.70 0.69
Gear Ranking
Optimizers
Ranking
  • Agi > Haste ~= Mastery > Vers ~= Crit
Pawn string ( Pawn: v1: "Sarkul": Agility=13.59, CritRating=10.67, HasteRating=12.39, MasteryRating=11.98, Versatility=11.04 )

Scale Factors for other metrics

Scale Factors for Sarkul Damage Per Second
Agi Haste Mastery Vers Crit
Scale Factors 13.59 12.39 11.98 11.04 10.67
Normalized 1.00 0.91 0.88 0.81 0.79
Scale Deltas 1138 1138 1138 1138 1138
Error 0.70 0.70 0.70 0.70 0.69
Gear Ranking
Optimizers
Ranking
  • Agi > Haste ~= Mastery > Vers ~= Crit
Pawn string ( Pawn: v1: "Sarkul": Agility=13.59, CritRating=10.67, HasteRating=12.39, MasteryRating=11.98, Versatility=11.04 )
Scale Factors for Sarkul Priority Target Damage Per Second
Agi Haste Mastery Vers Crit
Scale Factors 7.92 7.69 7.67 6.91 6.81
Normalized 1.00 0.97 0.97 0.87 0.86
Scale Deltas 1138 1138 1138 1138 1138
Error 0.27 0.27 0.27 0.27 0.27
Gear Ranking
Optimizers
Ranking
  • Agi ~= Haste ~= Mastery > Vers ~= Crit
Pawn string ( Pawn: v1: "Sarkul": Agility=7.92, CritRating=6.81, HasteRating=7.69, MasteryRating=7.67, Versatility=6.91 )
Scale Factors for Sarkul Damage Per Second (Effective)
Agi Haste Mastery Vers Crit
Scale Factors 13.59 12.39 11.98 11.04 10.67
Normalized 1.00 0.91 0.88 0.81 0.79
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Haste > Mastery > Vers > Crit
Pawn string ( Pawn: v1: "Sarkul": Agility=13.59, CritRating=10.67, HasteRating=12.39, MasteryRating=11.98, Versatility=11.04 )
Scale Factors for Sarkul Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Sarkul Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Sarkul Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Sarkul Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Sarkul Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Sarkul Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Sarkul Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for SarkulTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Sarkul 444936
Aimed Shot 113915 (133727) 25.7% (30.2%) 115.8 3.46sec 463148 278473 Direct 115.7 271036 627295 394933 34.8%  

Stats details: aimed_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 115.79 115.67 0.00 0.00 1.6632 0.0000 45683134.05 67158534.28 31.98 278472.65 278472.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.45 65.22% 271035.98 111112 295022 270949.58 245893 282303 20448360 30061027 31.98
crit 40.23 34.78% 627295.03 233336 944069 627187.75 547464 705267 25234774 37097508 31.98
 
 

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
Spelldata
  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals ${$sw1*$<mult>} Physical damage.{$?s19434=true}[][ Replaces Cobra Shot.]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.04
 
    Legacy of the Windrunners 19812 4.5% 0.0 0.00sec 0 0 Direct 103.4 52587 121947 76793 34.9%  

Stats details: legacy_of_the_windrunners

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 103.44 0.00 0.00 0.0000 0.0000 7943178.98 11677225.50 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.34 65.10% 52587.35 21787 57847 52585.85 36083 56580 3541107 5205763 31.98
crit 36.10 34.90% 121947.44 45752 185112 121802.77 83879 165630 4402072 6471462 31.98
 
 

Action details: legacy_of_the_windrunners

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190852
  • name:Legacy of the Windrunners
  • school:physical
  • tooltip:
  • description:Aimed Shot has a chance to coalesce {$s1=6} extra Wind Arrows that also shoot your target.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.40
 
auto_shot 13351 (88082) 3.0% (19.7%) 159.6 2.52sec 219307 87726 Direct 159.6 25090 54176 33511 29.0%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 159.65 159.65 0.00 0.00 2.4999 0.0000 5350029.54 7865050.19 31.98 87726.32 87726.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 113.43 71.05% 25090.28 24825 26398 25091.52 24944 25203 2845954 4183822 31.98
crit 46.22 28.95% 54175.86 49650 79195 54193.82 50333 59260 2504076 3681229 31.98
 
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    Volley 74731 16.7% 160.6 2.52sec 184639 0 Direct 543.8 42468 89439 54551 25.7%  

Stats details: volley

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 160.65 543.76 0.00 0.00 0.0000 0.0000 29662245.15 43606310.06 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 403.88 74.28% 42468.36 42058 45831 42468.59 42306 42631 17152317 25215530 31.98
crit 139.87 25.72% 89438.58 84116 137493 89407.94 84886 96089 12509928 18390780 31.98
 
 

Action details: volley

Static Values
  • id:194386
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:194386
  • name:Volley
  • school:physical
  • tooltip:Auto attacks also spend {$s1=3} Focus to launch a volley of shots that hit the target and all other nearby enemies.
  • description:While active, your auto attacks spend {$s1=3} Focus to also launch a volley of shots that hit the target and all other nearby enemies, dealing {$194392s1=0} additional Physical damage.
 
Deadly Grace 9667 2.1% 31.0 11.85sec 122869 0 Direct 31.0 80707 206105 122944 33.7%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.03 31.01 0.00 0.00 0.0000 0.0000 3812801.31 3812801.31 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.57 66.32% 80706.98 80707 80707 80706.98 80707 80707 1659921 1659921 0.00
crit 10.45 33.68% 206104.75 161414 242121 204850.93 0 242121 2152880 2152880 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Mark of the Hidden Satyr 3786 0.9% 22.5 17.81sec 67488 0 Direct 22.5 50459 109017 67489 29.1%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.48 22.48 0.00 0.00 0.0000 0.0000 1517112.60 1517112.60 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.94 70.92% 50459.06 50459 50459 50459.06 50459 50459 804443 804443 0.00
crit 6.54 29.08% 109016.64 100918 151377 108945.87 0 151377 712669 712669 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Marked Shot 117211 (127267) 26.3% (28.5%) 36.1 11.18sec 1402164 1124470 Direct 101.2 327344 693683 460442 36.3%  

Stats details: marked_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.09 101.23 0.00 0.00 1.2470 0.0000 46612267.85 68524448.97 31.98 1124469.94 1124469.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.45 63.67% 327344.23 133736 355090 327258.84 278193 342477 21098450 31016720 31.98
crit 36.78 36.33% 693682.78 267471 1065270 693636.65 562991 825306 25513818 37507729 31.98
 
 

Action details: marked_shot

Static Values
  • id:185901
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
Spelldata
  • id:185901
  • name:Marked Shot
  • school:physical
  • tooltip:
  • description:Rapidly fires shots at all targets with your Hunter's Mark, dealing $212621sw2 Physical damage and making them Vulnerable for {$187131d=30 seconds}. |Tinterface\icons\ability_hunter_mastermarksman.blp:24|t |cFFFFFFFFVulnerable|r {$@spelldesc187131=Damage taken from Marked Shot and Aimed Shot increased by {$s2=50}% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.50
 
    Call of the Hunter 10056 2.2% 14.4 52.80sec 276922 0 Direct 49.0 62085 133754 81450 27.0%  

Stats details: call_of_the_hunter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.41 49.00 0.00 0.00 0.0000 0.0000 3991128.31 5867336.66 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.76 72.98% 62085.00 61377 66883 62130.44 61377 66883 2220174 3263866 31.98
crit 13.24 27.02% 133753.81 122754 200649 133885.56 0 200649 1770954 2603471 31.95
 
 

Action details: call_of_the_hunter

Static Values
  • id:191070
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191070
  • name:Call of the Hunter
  • school:physical
  • tooltip:
  • description:{$@spelldesc191048=When you Marked Shot, |cFFFFCC99Thas'dorah|r has a chance to call forth a barrage of wind arrows to strike all Vulnerable targets.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Pepper Breath 3741 0.8% 17.9 22.05sec 83799 0 Periodic 88.4 16976 0 16976 0.0% 5.6%

Stats details: pepper_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.90 0.00 89.12 88.37 0.0000 0.2498 1500204.37 1500204.37 0.00 67388.57 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 88.4 100.00% 16975.99 68 16990 16976.63 16591 16990 1500204 1500204 0.00
 
 

Action details: pepper_breath

Static Values
  • id:225622
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225622
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Fires {$s1=4 to 6} fiery bolts, each dealing {$225624s1=16990} Fire damage.
 

Action details: pepper_breath_damage

Static Values
  • id:225624
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:17.5000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225624
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Deal {$s1=16990} Fire damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16990.00
  • base_dd_max:16990.00
 
Rancid Maw 11521 2.6% 18.0 22.02sec 256696 0 Direct 17.9 193161 417647 258253 29.0%  

Stats details: rancid_maw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.99 17.88 0.00 0.00 0.0000 0.0000 4617424.09 4617424.09 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.69 71.00% 193161.37 193161 193161 193161.37 193161 193161 2452100 2452100 0.00
crit 5.18 29.00% 417646.50 386323 579484 416263.23 0 579484 2165324 2165324 0.00
 
 

Action details: rancid_maw

Static Values
  • id:215405
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215405
  • name:Rancid Maw
  • school:nature
  • tooltip:
  • description:{$@spelldesc215404=Your ranged attacks and spells have a chance to launch a ball of venom that deals up to {$215405s1=112984 to 124877} Nature damage, based on your distance from the target (maximum damage at 20 yards).}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:180015.50
  • base_dd_max:198964.50
 
Sidewinders 45482 10.2% 41.1 9.82sec 438789 350671 Direct 139.5 100388 212005 129327 25.9%  

Stats details: sidewinders

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.12 139.51 0.00 0.00 1.2513 0.0000 18042745.53 18042745.53 0.00 350671.41 350671.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 103.34 74.07% 100388.23 99252 108156 100390.52 99333 101454 10374019 10374019 0.00
crit 36.17 25.93% 212005.34 198504 324467 211974.65 198504 247908 7668726 7668726 0.00
 
 

Action details: sidewinders

Static Values
  • id:214579
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
Spelldata
  • id:214579
  • name:Sidewinders
  • school:nature
  • tooltip:
  • description:Launches Sidewinders that travel toward the target, weaving back and forth and dealing {$214581s1=0} Nature damage to each target they hit. Cannot hit the same target twice. Applies Vulnerable to all targets hit. |cFFFFFFFFGenerates {$s2=50} Focus.|r{$?s214579=false}[][ |cFFFFD200Also replaces Multi-Shot.|r]
 
Windburst 21664 4.9% 15.9 24.53sec 546981 393921 Direct 16.8 391194 819451 515498 29.0%  

Stats details: windburst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.88 16.85 0.00 0.00 1.3886 0.0000 8685558.75 12768594.08 31.98 393920.76 393920.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.96 70.97% 391194.05 389049 413196 391168.67 389049 397098 4677737 6876717 31.98
crit 4.89 29.03% 819451.49 778098 1239587 816912.25 0 1203367 4007822 5891877 31.85
 
 

Action details: windburst

Static Values
  • id:204147
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:204147
  • name:Windburst
  • school:physical
  • tooltip:
  • description:Focuses the power of Wind through |cFFFFCC99Thas'dorah|r, dealing $sw1 Physical damage to your target, and leaving behind a trail of wind for {$204475d=5 seconds} that increases the movement speed of allies by {$204477s1=50}%.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:8.00
 
Simple Action Stats Execute Interval
Sarkul
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sarkul
  • harmful:false
  • if_expr:
 
Blood Fury 3.8 120.50sec

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.77 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by {$s1=2243}.
  • description:Increases attack power by {$s1=2243}. Lasts {$d=15 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sarkul
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Trueshot 2.6 206.64sec

Stats details: trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.56 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: trueshot

Static Values
  • id:193526
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:170.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16
Spelldata
  • id:193526
  • name:Trueshot
  • school:physical
  • tooltip:Haste increased by {$s1=40}% and Arcane Shot and Multi-Shot apply Hunter's Mark.
  • description:Increases haste by {$s1=40}% and causes Arcane Shot and Multi-Shot to always apply Hunter's Mark. Lasts {$d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blood Fury 3.8 0.0 120.5sec 120.5sec 13.90% 13.90% 0.0(0.0) 3.6

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:attack_power
  • amount:2243.00

Stack Uptimes

  • blood_fury_1:13.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by {$s1=2243}.
  • description:Increases attack power by {$s1=2243}. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.12% 24.99% 0.0(0.0) 1.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bullseye 10.4 226.6 31.0sec 1.5sec 36.33% 36.33% 100.7(100.7) 9.4

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_bullseye
  • max_stacks:30
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01

Stack Uptimes

  • bullseye_1:0.08%
  • bullseye_2:0.14%
  • bullseye_3:0.18%
  • bullseye_4:0.15%
  • bullseye_5:5.76%
  • bullseye_6:0.15%
  • bullseye_7:0.16%
  • bullseye_8:0.12%
  • bullseye_9:0.13%
  • bullseye_10:7.42%
  • bullseye_11:0.13%
  • bullseye_12:0.13%
  • bullseye_13:0.15%
  • bullseye_14:0.14%
  • bullseye_15:3.83%
  • bullseye_16:0.14%
  • bullseye_17:0.15%
  • bullseye_18:0.14%
  • bullseye_19:0.14%
  • bullseye_20:0.96%
  • bullseye_21:0.14%
  • bullseye_22:0.15%
  • bullseye_23:0.14%
  • bullseye_24:0.15%
  • bullseye_25:0.53%
  • bullseye_26:0.14%
  • bullseye_27:0.14%
  • bullseye_28:0.12%
  • bullseye_29:0.11%
  • bullseye_30:14.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:204090
  • name:Bullseye
  • tooltip:Critical strike chance increased by {$s1=1}%.
  • description:{$@spelldesc204089=When your abilities damage a target below {$s1=20}% health, you gain {$204090s1=1}% increased critical strike chance for {$204090d=6 seconds}, stacking up to {$204090u=30} times.}
  • max_stacks:30
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Lock and Load 12.3 0.5 30.9sec 29.7sec 7.46% 10.51% 0.5(0.6) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_lock_and_load
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lock_and_load_1:3.87%
  • lock_and_load_2:3.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:$@spelldesc198811
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Marking Targets 34.5 10.2 11.7sec 9.0sec 34.17% 49.98% 10.2(10.2) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_marking_targets
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • marking_targets_1:34.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:223138
  • name:Marking Targets
  • tooltip:Next {$?s214579=false}[Sidewinders][Arcane Shot or Multi-Shot] will apply Hunter's Mark.
  • description:Your next {$?s214579=false}[Sidewinders][Arcane Shot or Multi-Shot] will apply Hunter's Mark. Hunter's Mark activates Marked Shot.
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 316.3sec 0.0sec 14.68% 14.68% 0.0(0.0) 2.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:14.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 14.53% 14.53% 2.0(2.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.53%

Trigger Attempt Success

  • trigger_pct:100.00%
Rapid Killing 2.6 0.0 220.1sec 206.5sec 9.51% 14.40% 0.0(0.0) 2.6

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_rapid_killing
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • rapid_killing_1:9.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:191342
  • name:Rapid Killing
  • tooltip:Critical damage increased by {$s1=50}%.
  • description:{$@spelldesc191339=Trueshot also increases your critical strike damage by {$191342s1=50}% for its duration.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Trueshot 2.6 0.0 220.1sec 206.5sec 9.51% 16.39% 0.0(0.0) 2.6

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_trueshot
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40

Stack Uptimes

  • trueshot_1:9.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193526
  • name:Trueshot
  • tooltip:Haste increased by {$s1=40}% and Arcane Shot and Multi-Shot apply Hunter's Mark.
  • description:Increases haste by {$s1=40}% and causes Arcane Shot and Multi-Shot to always apply Hunter's Mark. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Volley

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_volley
  • max_stacks:1
  • duration:0.00
  • cooldown:1.50
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • volley_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194386
  • name:Volley
  • tooltip:Auto attacks also spend {$s1=3} Focus to launch a volley of shots that hit the target and all other nearby enemies.
  • description:While active, your auto attacks spend {$s1=3} Focus to also launch a volley of shots that hit the target and all other nearby enemies, dealing {$194392s1=0} additional Physical damage.
  • max_stacks:0
  • duration:-0.00
  • cooldown:1.50
  • default_chance:100.00%

Resources

Resource Usage Type Count Total Average RPE APR
Sarkul
aimed_shot Focus 115.8 4544.8 39.3 39.3 11799.4
marked_shot Focus 36.1 1082.7 30.0 30.0 46739.4
volley Focus 159.7 479.0 3.0 3.0 61931.8
windburst Focus 16.9 337.6 20.0 21.3 25728.8
Resource Gains Type Count Total Average Overflow
sidewinders Focus 41.12 1955.95 (30.67%) 47.57 100.03 4.87%
focus_regen Focus 1341.94 4422.36 (69.33%) 3.30 342.06 7.18%
Resource RPS-Gain RPS-Loss
Focus 15.91 16.07
Combat End Resource Mean Min Max
Focus 85.01 16.85 150.00

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 4.4%

Procs

Count Interval
lock_and_load 12.8 29.7sec
no_vuln_aimed_shot 4.8 49.4sec
no_vuln_marked_shot 6.2 45.3sec
marking_targets 44.7 9.0sec
wasted_marking_targets 10.2 35.8sec

Statistics & Data Analysis

Fight Length
Sample Data Sarkul Fight Length
Count 9999
Mean 401.00
Minimum 308.02
Maximum 501.87
Spread ( max - min ) 193.85
Range [ ( max - min ) / 2 * 100% ] 24.17%
DPS
Sample Data Sarkul Damage Per Second
Count 9999
Mean 444936.36
Minimum 364609.21
Maximum 566950.87
Spread ( max - min ) 202341.66
Range [ ( max - min ) / 2 * 100% ] 22.74%
Standard Deviation 28194.0593
5th Percentile 403684.51
95th Percentile 495940.23
( 95th Percentile - 5th Percentile ) 92255.72
Mean Distribution
Standard Deviation 281.9547
95.00% Confidence Intervall ( 444383.73 - 445488.98 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 154
0.1% Error 15424
0.1 Scale Factor Error with Delta=300 6785766
0.05 Scale Factor Error with Delta=300 27143064
0.01 Scale Factor Error with Delta=300 678576612
Priority Target DPS
Sample Data Sarkul Priority Target Damage Per Second
Count 9999
Mean 280293.54
Minimum 238033.49
Maximum 322728.12
Spread ( max - min ) 84694.63
Range [ ( max - min ) / 2 * 100% ] 15.11%
Standard Deviation 10945.4146
5th Percentile 262583.82
95th Percentile 298729.73
( 95th Percentile - 5th Percentile ) 36145.92
Mean Distribution
Standard Deviation 109.4596
95.00% Confidence Intervall ( 280079.01 - 280508.08 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 58
0.1% Error 5857
0.1 Scale Factor Error with Delta=300 1022699
0.05 Scale Factor Error with Delta=300 4090798
0.01 Scale Factor Error with Delta=300 102269963
DPS(e)
Sample Data Sarkul Damage Per Second (Effective)
Count 9999
Mean 444936.36
Minimum 364609.21
Maximum 566950.87
Spread ( max - min ) 202341.66
Range [ ( max - min ) / 2 * 100% ] 22.74%
Damage
Sample Data Sarkul Damage
Count 9999
Mean 177417830.53
Minimum 135479819.98
Maximum 227738367.58
Spread ( max - min ) 92258547.60
Range [ ( max - min ) / 2 * 100% ] 26.00%
DTPS
Sample Data Sarkul Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Sarkul Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Sarkul Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Sarkul Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Sarkul Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Sarkul Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data SarkulTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Sarkul Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=fishbrul_special
2 0.00 summon_pet
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
5 0.00 augmentation,type=defiled
6 0.00 volley
7 0.00 windburst
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 auto_shot
0.00 arcane_torrent,if=focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
9 3.78 blood_fury
0.00 berserking
0.00 auto_shot
0.00 variable,name=vulnerable_time,value=debuff.vulnerability.remains
A 0.00 call_action_list,name=open,if=time<=15&talent.sidewinders.enabled&active_enemies=1
B 0.00 call_action_list,name=cooldowns
0.00 a_murder_of_crows,if=debuff.hunters_mark.down
C 0.00 call_action_list,name=trueshotaoe,if=active_enemies>1&!talent.sidewinders.enabled&buff.trueshot.up
0.00 barrage,if=debuff.hunters_mark.down
0.00 black_arrow,if=debuff.hunters_mark.down
0.00 a_murder_of_crows,if=(target.health.pct>30|target.health.pct<=20)&variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>60&focus+(focus.regen*debuff.hunters_mark.remains)>=60
0.00 barrage,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>90&focus+(focus.regen*debuff.hunters_mark.remains)>=90
0.00 black_arrow,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>70&focus+(focus.regen*debuff.hunters_mark.remains)>=70
0.00 piercing_shot,if=!talent.patient_sniper.enabled&focus>50
D 17.82 windburst,if=(!talent.patient_sniper.enabled|talent.sidewinders.enabled)&(debuff.hunters_mark.down|debuff.hunters_mark.remains>execute_time&focus+(focus.regen*debuff.hunters_mark.remains)>50)
0.00 windburst,if=talent.patient_sniper.enabled&!talent.sidewinders.enabled&((debuff.vulnerability.down|debuff.vulnerability.remains<2)|(debuff.hunters_mark.up&buff.marking_targets.up&debuff.vulnerability.down))
E 0.00 call_action_list,name=targetdie,if=target.time_to_die<6&active_enemies=1
F 9.98 sidewinders,if=(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
0.00 sentinel,if=debuff.hunters_mark.down&(buff.marking_targets.down|buff.trueshot.up)
0.00 marked_shot,target=2,if=!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
0.00 arcane_shot,if=!talent.patient_sniper.enabled&spell_targets.barrage=1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
0.00 multishot,if=!talent.patient_sniper.enabled&spell_targets.barrage>1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
0.00 arcane_shot,if=talent.steady_focus.enabled&spell_targets.barrage=1&(buff.steady_focus.down|buff.steady_focus.remains<2)
0.00 multishot,if=talent.steady_focus.enabled&spell_targets.barrage>1&(buff.steady_focus.down|buff.steady_focus.remains<2)
0.00 explosive_shot
0.00 marked_shot,if=!talent.patient_sniper.enabled|(talent.barrage.enabled&spell_targets.barrage>2)
G 57.85 aimed_shot,if=debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
H 55.86 aimed_shot,if=debuff.hunters_mark.down&debuff.vulnerability.remains>execute_time&(talent.sidewinders.enabled|buff.marking_targets.down|(debuff.hunters_mark.remains>execute_time+gcd&focus+5+focus.regen*debuff.hunters_mark.remains>80))
I 30.56 marked_shot,if=debuff.hunters_mark.remains<1|variable.vulnerable_time<1|spell_targets.barrage>1|buff.trueshot.up
J 1.25 marked_shot,if=buff.marking_targets.up&(!talent.sidewinders.enabled|cooldown.sidewinders.charges_fractional>=1.2)
K 26.64 sidewinders,if=buff.marking_targets.up&debuff.hunters_mark.down&(focus<=80|(variable.vulnerable_time<2&cooldown.windburst.remains>3&cooldown.sidewinders.charges_fractional>=1.2))
0.00 piercing_shot,if=talent.patient_sniper.enabled&focus>80
0.00 arcane_shot,if=spell_targets.barrage=1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
0.00 multishot,if=spell_targets.barrage>1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
L 6.58 aimed_shot,if=debuff.vulnerability.down&focus>80&cooldown.windburst.remains>3
0.00 multishot,if=spell_targets.barrage>2
actions.cooldowns
# count action,conditions
M 1.00 potion,name=deadly_grace,if=(buff.trueshot.react&buff.bloodlust.react)|buff.bullseye.react>=23|target.time_to_die<31
N 1.56 /trueshot,if=buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16
actions.open
# count action,conditions
0.00 a_murder_of_crows
O 1.00 trueshot
P 1.53 sidewinders,if=(buff.marking_targets.down&buff.trueshot.remains<2)|(charges_fractional>=1.9&focus<80)
Q 3.48 marked_shot
R 1.09 aimed_shot,if=buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
0.00 black_arrow
0.00 barrage
S 8.73 aimed_shot,if=execute_time<debuff.vulnerability.remains
T 2.13 sidewinders
0.00 aimed_shot
0.00 arcane_shot
actions.targetdie
# count action,conditions
U 0.79 marked_shot
0.00 windburst
V 1.61 aimed_shot,if=execute_time<debuff.vulnerability.remains
W 0.84 sidewinders
X 0.07 aimed_shot
0.00 arcane_shot

Sample Sequence

0456789OSSPQSSTQSSTQSRSPQHHHDKIHHLKGGGIHHKDGIHKIHHKGIHHDHKGGIKGGIHKDGGIHKGGIHKDIHHLL9LKGIHHKDGGGIKGGIKDGGIHHKGGIHNDHHHHFGGGGIHHFGGDGJKIHHLFHHHDHHFGGIHFHHD9HHHFGGJHHKGGJKIDHHHLKGGGIHDHFGIHHKGIHHKGDGGIKGGIKGGIDHHHLFGGMINFGDGIFGGGGI9FGGGIKGDGGGIHHKGGIHWUD

Sample Sequence Table

time name target resources buffs
Pre flask Sarkul 150.0/150: 100% focus
Pre potion Fluffy_Pillow 150.0/150: 100% focus potion_of_deadly_grace
Pre augmentation Sarkul 150.0/150: 100% focus potion_of_deadly_grace
Pre volley Fluffy_Pillow 150.0/150: 100% focus potion_of_deadly_grace
0:00.000 windburst Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 start_auto_shot Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 blood_fury Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 trueshot Fluffy_Pillow 130.0/150: 87% focus blood_fury, potion_of_deadly_grace
0:00.000 aimed_shot Fluffy_Pillow 130.0/150: 87% focus blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:01.292 aimed_shot Fluffy_Pillow 96.6/150: 64% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:02.286 sidewinders Fluffy_Pillow 66.6/150: 44% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:03.041 marked_shot Fluffy_Pillow 128.9/150: 86% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:03.797 aimed_shot Fluffy_Pillow 114.1/150: 76% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:04.792 aimed_shot Fluffy_Pillow 81.2/150: 54% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:05.790 sidewinders Fluffy_Pillow 48.3/150: 32% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:06.543 marked_shot Fluffy_Pillow 113.5/150: 76% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:07.298 aimed_shot Fluffy_Pillow 95.8/150: 64% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:08.294 aimed_shot Fluffy_Pillow 65.9/150: 44% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:09.288 sidewinders Fluffy_Pillow 32.9/150: 22% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:10.043 marked_shot Fluffy_Pillow 95.2/150: 63% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:10.798 aimed_shot Fluffy_Pillow 80.4/150: 54% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:11.794 aimed_shot Fluffy_Pillow 97.5/150: 65% focus bloodlust, blood_fury, lock_and_load, rapid_killing, trueshot, potion_of_deadly_grace
0:12.548 Waiting 0.600 sec 112.7/150: 75% focus bloodlust, blood_fury, raid_movement, rapid_killing, trueshot, potion_of_deadly_grace
0:13.148 aimed_shot Fluffy_Pillow 121.8/150: 81% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:14.143 sidewinders Fluffy_Pillow 91.9/150: 61% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:14.936 marked_shot Fluffy_Pillow 150.0/150: 100% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:15.690 aimed_shot Fluffy_Pillow 131.2/150: 87% focus bloodlust, marking_targets, potion_of_deadly_grace
0:17.084 aimed_shot Fluffy_Pillow 98.3/150: 66% focus bloodlust, marking_targets, potion_of_deadly_grace
0:18.476 aimed_shot Fluffy_Pillow 65.4/150: 44% focus bloodlust, marking_targets, potion_of_deadly_grace
0:19.866 windburst Fluffy_Pillow 35.4/150: 24% focus bloodlust, marking_targets, potion_of_deadly_grace
0:21.045 sidewinders Fluffy_Pillow 29.4/150: 20% focus bloodlust, raid_movement, marking_targets, potion_of_deadly_grace
0:22.091 marked_shot Fluffy_Pillow 94.5/150: 63% focus bloodlust, raid_movement, potion_of_deadly_grace
0:23.135 Waiting 0.500 sec 76.5/150: 51% focus bloodlust, raid_movement, potion_of_deadly_grace
0:23.635 aimed_shot Fluffy_Pillow 83.7/150: 56% focus bloodlust, potion_of_deadly_grace
0:25.026 aimed_shot Fluffy_Pillow 50.8/150: 34% focus bloodlust, potion_of_deadly_grace
0:26.417 Waiting 4.800 sec 17.8/150: 12% focus bloodlust, potion_of_deadly_grace
0:31.217 aimed_shot Fluffy_Pillow 81.0/150: 54% focus bloodlust
0:32.607 sidewinders Fluffy_Pillow 48.1/150: 32% focus bloodlust, marking_targets
0:33.652 aimed_shot Fluffy_Pillow 113.1/150: 75% focus bloodlust
0:35.042 aimed_shot Fluffy_Pillow 130.2/150: 87% focus bloodlust, lock_and_load
0:36.086 aimed_shot Fluffy_Pillow 145.2/150: 97% focus bloodlust
0:37.479 marked_shot Fluffy_Pillow 100.1/150: 67% focus bloodlust, bullseye(5), marking_targets
0:38.522 aimed_shot Fluffy_Pillow 85.1/150: 57% focus bloodlust, bullseye(10), marking_targets
0:39.916 aimed_shot Fluffy_Pillow 52.2/150: 35% focus bloodlust, bullseye(15), marking_targets
0:41.309 sidewinders Fluffy_Pillow 17.7/150: 12% focus bullseye(15), marking_targets
0:42.665 windburst Fluffy_Pillow 82.7/150: 55% focus bullseye(15)
0:44.020 Waiting 1.200 sec 97.8/150: 65% focus raid_movement, bullseye(15)
0:45.220 aimed_shot Fluffy_Pillow 108.1/150: 72% focus
0:47.028 marked_shot Fluffy_Pillow 78.1/150: 52% focus
0:48.384 aimed_shot Fluffy_Pillow 60.1/150: 40% focus
0:50.004 sidewinders Fluffy_Pillow 75.1/150: 50% focus raid_movement, marking_targets
0:51.359 marked_shot Fluffy_Pillow 140.1/150: 93% focus raid_movement
0:52.716 Waiting 0.900 sec 122.2/150: 81% focus raid_movement, marking_targets
0:53.616 aimed_shot Fluffy_Pillow 132.1/150: 88% focus marking_targets
0:55.424 aimed_shot Fluffy_Pillow 98.4/150: 66% focus marking_targets
0:57.230 sidewinders Fluffy_Pillow 68.4/150: 46% focus marking_targets
0:58.587 aimed_shot Fluffy_Pillow 130.4/150: 87% focus
1:00.005 marked_shot Fluffy_Pillow 146.2/150: 97% focus raid_movement
1:01.361 aimed_shot Fluffy_Pillow 128.2/150: 85% focus
1:03.169 aimed_shot Fluffy_Pillow 98.2/150: 65% focus
1:04.977 windburst Fluffy_Pillow 65.3/150: 44% focus
1:06.334 aimed_shot Fluffy_Pillow 57.3/150: 38% focus bullseye(5), marking_targets
1:08.142 sidewinders Fluffy_Pillow 27.4/150: 18% focus bullseye(5), marking_targets
1:09.499 aimed_shot Fluffy_Pillow 89.4/150: 60% focus bullseye(15), marking_targets
1:11.307 aimed_shot Fluffy_Pillow 59.5/150: 40% focus bullseye(15), marking_targets
1:13.115 Waiting 0.400 sec 26.5/150: 18% focus bullseye(15), marking_targets
1:13.515 marked_shot Fluffy_Pillow 30.9/150: 21% focus bullseye(15), marking_targets
1:14.872 Waiting 0.100 sec 13.0/150: 9% focus marking_targets
1:14.972 sidewinders Fluffy_Pillow 14.1/150: 9% focus marking_targets
1:16.551 Waiting 0.600 sec 81.6/150: 54% focus raid_movement
1:17.151 aimed_shot Fluffy_Pillow 85.3/150: 57% focus marking_targets
1:18.957 aimed_shot Fluffy_Pillow 55.3/150: 37% focus marking_targets
1:20.312 marked_shot Fluffy_Pillow 67.3/150: 45% focus raid_movement, marking_targets
1:21.667 Waiting 2.000 sec 52.3/150: 35% focus raid_movement, marking_targets
1:23.667 aimed_shot Fluffy_Pillow 71.5/150: 48% focus marking_targets
1:25.474 Waiting 0.300 sec 38.5/150: 26% focus marking_targets
1:25.774 sidewinders Fluffy_Pillow 41.9/150: 28% focus marking_targets
1:27.373 windburst Fluffy_Pillow 109.6/150: 73% focus
1:28.730 aimed_shot Fluffy_Pillow 101.6/150: 68% focus
1:30.537 aimed_shot Fluffy_Pillow 68.7/150: 46% focus
1:32.006 marked_shot Fluffy_Pillow 85.0/150: 57% focus raid_movement
1:33.362 aimed_shot Fluffy_Pillow 67.0/150: 45% focus marking_targets
1:35.168 Waiting 1.500 sec 37.0/150: 25% focus marking_targets
1:36.668 sidewinders Fluffy_Pillow 50.6/150: 34% focus marking_targets
1:38.197 aimed_shot Fluffy_Pillow 117.6/150: 78% focus bullseye(5)
1:40.004 aimed_shot Fluffy_Pillow 84.6/150: 56% focus bullseye(10), marking_targets
1:41.810 Waiting 0.100 sec 51.6/150: 34% focus bullseye(10), marking_targets
1:41.910 marked_shot Fluffy_Pillow 52.8/150: 35% focus bullseye(10), marking_targets
1:43.265 Waiting 1.400 sec 37.8/150: 25% focus bullseye(10), marking_targets
1:44.665 aimed_shot Fluffy_Pillow 50.3/150: 34% focus marking_targets
1:46.473 Waiting 1.000 sec 20.3/150: 14% focus marking_targets
1:47.473 sidewinders Fluffy_Pillow 28.4/150: 19% focus lock_and_load(2), marking_targets
1:49.019 Waiting 0.200 sec 95.6/150: 64% focus raid_movement, lock_and_load(2)
1:49.219 windburst Fluffy_Pillow 97.8/150: 65% focus lock_and_load(2)
1:50.576 marked_shot Fluffy_Pillow 109.8/150: 73% focus raid_movement, lock_and_load(2)
1:51.932 Waiting 1.700 sec 94.9/150: 63% focus raid_movement, lock_and_load(2)
1:53.632 aimed_shot Fluffy_Pillow 110.7/150: 74% focus lock_and_load(2)
1:54.989 aimed_shot Fluffy_Pillow 122.8/150: 82% focus lock_and_load(2), marking_targets
1:56.345 Waiting 0.300 sec 137.8/150: 92% focus lock_and_load, marking_targets
1:56.645 aimed_shot Fluffy_Pillow 141.1/150: 94% focus lock_and_load, marking_targets
1:58.000 aimed_shot Fluffy_Pillow 150.0/150: 100% focus marking_targets
1:59.808 blood_fury Fluffy_Pillow 100.1/150: 67% focus marking_targets
2:00.000 aimed_shot Fluffy_Pillow 102.2/150: 68% focus blood_fury, marking_targets
2:01.807 sidewinders Fluffy_Pillow 69.2/150: 46% focus blood_fury, marking_targets
2:03.164 aimed_shot Fluffy_Pillow 131.3/150: 88% focus blood_fury
2:04.521 marked_shot Fluffy_Pillow 146.3/150: 98% focus blood_fury, raid_movement
2:05.876 aimed_shot Fluffy_Pillow 128.3/150: 86% focus blood_fury, marking_targets
2:07.683 aimed_shot Fluffy_Pillow 98.4/150: 66% focus blood_fury, marking_targets
2:09.491 sidewinders Fluffy_Pillow 65.4/150: 44% focus blood_fury, bullseye(5), marking_targets
2:10.849 windburst Fluffy_Pillow 130.5/150: 87% focus blood_fury, bullseye(10)
2:12.205 aimed_shot Fluffy_Pillow 122.5/150: 82% focus blood_fury, bullseye(10)
2:14.015 aimed_shot Fluffy_Pillow 89.6/150: 60% focus blood_fury, bullseye(10)
2:15.822 aimed_shot Fluffy_Pillow 59.6/150: 40% focus
2:17.628 Waiting 0.400 sec 26.6/150: 18% focus marking_targets
2:18.028 marked_shot Fluffy_Pillow 31.1/150: 21% focus marking_targets
2:19.384 Waiting 0.500 sec 13.1/150: 9% focus marking_targets
2:19.884 sidewinders Fluffy_Pillow 18.6/150: 12% focus marking_targets
2:21.491 aimed_shot Fluffy_Pillow 86.4/150: 58% focus
2:23.298 aimed_shot Fluffy_Pillow 53.5/150: 36% focus
2:25.105 Waiting 0.900 sec 20.5/150: 14% focus
2:26.005 marked_shot Fluffy_Pillow 30.5/150: 20% focus
2:27.363 Waiting 3.400 sec 12.6/150: 8% focus
2:30.763 sidewinders Fluffy_Pillow 47.2/150: 31% focus marking_targets
2:32.312 windburst Fluffy_Pillow 114.4/150: 76% focus
2:33.668 aimed_shot Fluffy_Pillow 106.5/150: 71% focus marking_targets
2:35.476 aimed_shot Fluffy_Pillow 73.5/150: 49% focus marking_targets
2:36.831 marked_shot Fluffy_Pillow 88.5/150: 59% focus raid_movement, marking_targets
2:38.188 aimed_shot Fluffy_Pillow 70.6/150: 47% focus bullseye(10), marking_targets
2:39.997 Waiting 0.800 sec 40.6/150: 27% focus bullseye(10), marking_targets
2:40.797 aimed_shot Fluffy_Pillow 46.5/150: 31% focus bullseye(10), lock_and_load(2), marking_targets
2:42.153 sidewinders Fluffy_Pillow 61.5/150: 41% focus bullseye(10), lock_and_load, marking_targets
2:43.507 aimed_shot Fluffy_Pillow 123.5/150: 82% focus bullseye(10), lock_and_load
2:44.864 aimed_shot Fluffy_Pillow 138.6/150: 92% focus
2:46.671 Waiting 0.500 sec 100.0/150: 67% focus
2:47.171 marked_shot Fluffy_Pillow 105.6/150: 70% focus
2:48.529 aimed_shot Fluffy_Pillow 90.6/150: 60% focus
2:50.004 trueshot Fluffy_Pillow 104.0/150: 69% focus raid_movement
2:50.004 Waiting 3.500 sec 104.0/150: 69% focus raid_movement, rapid_killing, trueshot
2:53.504 windburst Fluffy_Pillow 150.0/150: 100% focus rapid_killing, trueshot
2:54.633 aimed_shot Fluffy_Pillow 130.0/150: 87% focus marking_targets, rapid_killing, trueshot
2:55.926 aimed_shot Fluffy_Pillow 147.1/150: 98% focus lock_and_load, marking_targets, rapid_killing, trueshot
2:56.896 aimed_shot Fluffy_Pillow 150.0/150: 100% focus marking_targets, rapid_killing, trueshot
2:58.188 aimed_shot Fluffy_Pillow 100.1/150: 67% focus marking_targets, rapid_killing, trueshot
2:59.482 sidewinders Fluffy_Pillow 67.1/150: 45% focus marking_targets, rapid_killing, trueshot
3:00.454 aimed_shot Fluffy_Pillow 132.2/150: 88% focus rapid_killing, trueshot
3:01.745 aimed_shot Fluffy_Pillow 149.3/150: 100% focus lock_and_load, marking_targets, rapid_killing, trueshot
3:02.715 aimed_shot Fluffy_Pillow 150.0/150: 100% focus marking_targets, rapid_killing, trueshot
3:04.009 aimed_shot Fluffy_Pillow 100.1/150: 67% focus marking_targets, rapid_killing, trueshot
3:05.302 marked_shot Fluffy_Pillow 115.8/150: 77% focus lock_and_load, marking_targets
3:06.657 aimed_shot Fluffy_Pillow 100.9/150: 67% focus lock_and_load, marking_targets
3:08.013 Waiting 1.200 sec 112.9/150: 75% focus raid_movement, bullseye(5), marking_targets
3:09.213 aimed_shot Fluffy_Pillow 126.2/150: 84% focus bullseye(5), marking_targets
3:11.021 sidewinders Fluffy_Pillow 93.2/150: 62% focus bullseye(5), marking_targets
3:12.377 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bullseye(5)
3:14.184 aimed_shot Fluffy_Pillow 100.0/150: 67% focus marking_targets
3:15.991 windburst Fluffy_Pillow 67.1/150: 45% focus marking_targets
3:17.347 aimed_shot Fluffy_Pillow 62.1/150: 41% focus marking_targets
3:19.155 Waiting 0.100 sec 29.2/150: 19% focus marking_targets
3:19.255 marked_shot Fluffy_Pillow 30.3/150: 20% focus marking_targets
3:20.609 sidewinders Fluffy_Pillow 15.3/150: 10% focus raid_movement, marking_targets
3:21.965 marked_shot Fluffy_Pillow 77.3/150: 52% focus raid_movement
3:23.319 Waiting 0.300 sec 62.3/150: 42% focus raid_movement
3:23.619 aimed_shot Fluffy_Pillow 65.6/150: 44% focus
3:24.976 Waiting 0.200 sec 77.7/150: 52% focus raid_movement
3:25.176 aimed_shot Fluffy_Pillow 79.9/150: 53% focus
3:26.983 Waiting 3.300 sec 46.9/150: 31% focus
3:30.283 aimed_shot Fluffy_Pillow 80.5/150: 54% focus
3:32.091 sidewinders Fluffy_Pillow 50.6/150: 34% focus
3:33.446 aimed_shot Fluffy_Pillow 112.6/150: 75% focus lock_and_load(2)
3:34.802 aimed_shot Fluffy_Pillow 127.6/150: 85% focus lock_and_load
3:36.157 aimed_shot Fluffy_Pillow 139.7/150: 93% focus marking_targets
3:37.967 windburst Fluffy_Pillow 100.1/150: 67% focus bullseye(5), marking_targets
3:39.323 aimed_shot Fluffy_Pillow 95.1/150: 63% focus bullseye(5), marking_targets
3:40.680 Waiting 0.500 sec 107.2/150: 71% focus raid_movement, bullseye(5), marking_targets
3:41.180 aimed_shot Fluffy_Pillow 112.7/150: 75% focus bullseye(5), marking_targets
3:42.985 sidewinders Fluffy_Pillow 82.7/150: 55% focus bullseye(5), marking_targets
3:44.341 aimed_shot Fluffy_Pillow 144.7/150: 96% focus
3:46.149 aimed_shot Fluffy_Pillow 100.1/150: 67% focus
3:47.957 Waiting 0.100 sec 70.1/150: 47% focus
3:48.057 marked_shot Fluffy_Pillow 71.2/150: 47% focus
3:49.414 aimed_shot Fluffy_Pillow 53.3/150: 36% focus
3:50.771 Waiting 2.600 sec 68.3/150: 46% focus raid_movement
3:53.371 sidewinders Fluffy_Pillow 94.1/150: 63% focus raid_movement
3:54.728 aimed_shot Fluffy_Pillow 150.0/150: 100% focus
3:56.086 Waiting 1.100 sec 150.0/150: 100% focus raid_movement
3:57.186 aimed_shot Fluffy_Pillow 150.0/150: 100% focus
3:58.993 Waiting 0.100 sec 100.0/150: 67% focus
3:59.093 windburst Fluffy_Pillow 101.2/150: 67% focus
4:00.675 blood_fury Fluffy_Pillow 95.7/150: 64% focus
4:00.675 aimed_shot Fluffy_Pillow 95.7/150: 64% focus blood_fury
4:02.484 aimed_shot Fluffy_Pillow 112.7/150: 75% focus blood_fury, lock_and_load, marking_targets
4:03.840 aimed_shot Fluffy_Pillow 127.8/150: 85% focus blood_fury, marking_targets
4:05.646 sidewinders Fluffy_Pillow 94.8/150: 63% focus blood_fury, marking_targets
4:07.004 aimed_shot Fluffy_Pillow 150.0/150: 100% focus blood_fury
4:08.812 aimed_shot Fluffy_Pillow 150.0/150: 100% focus blood_fury, bullseye(5), lock_and_load, marking_targets
4:10.167 marked_shot Fluffy_Pillow 148.2/150: 99% focus blood_fury, bullseye(5), marking_targets
4:11.523 aimed_shot Fluffy_Pillow 133.2/150: 89% focus blood_fury, bullseye(5), marking_targets
4:12.880 Waiting 0.300 sec 145.3/150: 97% focus blood_fury, raid_movement, bullseye(5), marking_targets
4:13.180 aimed_shot Fluffy_Pillow 148.6/150: 99% focus blood_fury, bullseye(5), marking_targets
4:14.988 sidewinders Fluffy_Pillow 100.1/150: 67% focus blood_fury, marking_targets
4:16.344 aimed_shot Fluffy_Pillow 150.0/150: 100% focus marking_targets
4:18.152 aimed_shot Fluffy_Pillow 100.1/150: 67% focus marking_targets
4:19.959 marked_shot Fluffy_Pillow 67.1/150: 45% focus marking_targets
4:21.317 sidewinders Fluffy_Pillow 49.1/150: 33% focus raid_movement, marking_targets
4:22.674 marked_shot Fluffy_Pillow 114.2/150: 76% focus raid_movement
4:24.029 windburst Fluffy_Pillow 96.2/150: 64% focus
4:25.386 aimed_shot Fluffy_Pillow 91.3/150: 61% focus
4:27.195 aimed_shot Fluffy_Pillow 58.3/150: 39% focus
4:28.552 Waiting 0.600 sec 73.4/150: 49% focus raid_movement
4:29.152 aimed_shot Fluffy_Pillow 77.0/150: 51% focus
4:30.958 Waiting 3.300 sec 47.0/150: 31% focus
4:34.258 aimed_shot Fluffy_Pillow 80.6/150: 54% focus
4:36.063 sidewinders Fluffy_Pillow 47.6/150: 32% focus marking_targets
4:37.420 aimed_shot Fluffy_Pillow 109.7/150: 73% focus bullseye(10), lock_and_load(2)
4:38.777 aimed_shot Fluffy_Pillow 124.7/150: 83% focus bullseye(10), lock_and_load
4:40.133 aimed_shot Fluffy_Pillow 136.8/150: 91% focus bullseye(15), lock_and_load(2), marking_targets
4:41.490 marked_shot Fluffy_Pillow 150.0/150: 100% focus bullseye(15), lock_and_load, marking_targets
4:42.847 aimed_shot Fluffy_Pillow 132.0/150: 88% focus bullseye(15), lock_and_load, marking_targets
4:44.203 Waiting 1.000 sec 147.1/150: 98% focus raid_movement, bullseye(15), marking_targets
4:45.203 windburst Fluffy_Pillow 150.0/150: 100% focus bullseye(15), marking_targets
4:46.739 aimed_shot Fluffy_Pillow 130.1/150: 87% focus marking_targets
4:48.545 sidewinders Fluffy_Pillow 147.1/150: 98% focus lock_and_load, marking_targets
4:49.902 aimed_shot Fluffy_Pillow 150.0/150: 100% focus lock_and_load
4:51.259 marked_shot Fluffy_Pillow 150.0/150: 100% focus raid_movement
4:52.614 Waiting 1.000 sec 135.0/150: 90% focus raid_movement
4:53.614 aimed_shot Fluffy_Pillow 143.1/150: 95% focus marking_targets
4:55.420 aimed_shot Fluffy_Pillow 100.0/150: 67% focus marking_targets
4:57.229 sidewinders Fluffy_Pillow 67.1/150: 45% focus marking_targets
4:58.584 aimed_shot Fluffy_Pillow 132.1/150: 88% focus
5:00.005 marked_shot Fluffy_Pillow 144.9/150: 97% focus raid_movement
5:01.363 aimed_shot Fluffy_Pillow 129.9/150: 87% focus
5:03.171 aimed_shot Fluffy_Pillow 97.0/150: 65% focus marking_targets
5:04.979 sidewinders Fluffy_Pillow 64.0/150: 43% focus marking_targets
5:06.336 aimed_shot Fluffy_Pillow 129.1/150: 86% focus
5:08.143 windburst Fluffy_Pillow 96.1/150: 64% focus bullseye(5)
5:09.500 aimed_shot Fluffy_Pillow 91.1/150: 61% focus bullseye(5)
5:11.308 aimed_shot Fluffy_Pillow 58.2/150: 39% focus bullseye(10)
5:13.115 Waiting 1.400 sec 25.2/150: 17% focus bullseye(10)
5:14.515 marked_shot Fluffy_Pillow 40.7/150: 27% focus bullseye(10)
5:15.873 sidewinders Fluffy_Pillow 22.8/150: 15% focus marking_targets
5:17.228 aimed_shot Fluffy_Pillow 87.8/150: 59% focus
5:19.035 aimed_shot Fluffy_Pillow 54.8/150: 37% focus
5:20.843 Waiting 0.800 sec 21.9/150: 15% focus
5:21.643 marked_shot Fluffy_Pillow 30.8/150: 21% focus
5:22.999 Waiting 0.100 sec 15.8/150: 11% focus
5:23.099 sidewinders Fluffy_Pillow 13.9/150: 9% focus marking_targets
5:24.457 aimed_shot Fluffy_Pillow 79.0/150: 53% focus
5:26.267 aimed_shot Fluffy_Pillow 96.0/150: 64% focus bullseye(2), lock_and_load
5:27.624 Waiting 0.500 sec 111.1/150: 74% focus bullseye(4)
5:28.124 marked_shot Fluffy_Pillow 116.6/150: 78% focus bullseye(4)
5:29.481 windburst Fluffy_Pillow 98.7/150: 66% focus bullseye(7)
5:30.851 aimed_shot Fluffy_Pillow 93.8/150: 63% focus bullseye(7)
5:32.208 Waiting 1.000 sec 105.9/150: 71% focus raid_movement, bullseye(10)
5:33.208 aimed_shot Fluffy_Pillow 117.0/150: 78% focus bullseye(10)
5:35.016 aimed_shot Fluffy_Pillow 84.0/150: 56% focus bullseye(12)
5:36.824 Waiting 2.900 sec 51.1/150: 34% focus bullseye(15)
5:39.724 aimed_shot Fluffy_Pillow 80.2/150: 53% focus bullseye(18)
5:41.531 Waiting 0.500 sec 50.3/150: 34% focus bullseye(18)
5:42.031 sidewinders Fluffy_Pillow 52.8/150: 35% focus bullseye(21), marking_targets
5:43.386 aimed_shot Fluffy_Pillow 117.8/150: 79% focus bullseye(22)
5:45.194 aimed_shot Fluffy_Pillow 84.9/150: 57% focus bullseye(24)
5:47.001 potion Fluffy_Pillow 54.9/150: 37% focus bullseye(25)
5:47.001 Waiting 0.100 sec 54.9/150: 37% focus bullseye(25), potion_of_deadly_grace
5:47.101 marked_shot Fluffy_Pillow 56.0/150: 37% focus bullseye(25), potion_of_deadly_grace
5:48.457 trueshot Fluffy_Pillow 38.0/150: 25% focus raid_movement, bullseye(29), potion_of_deadly_grace
5:48.457 Waiting 0.600 sec 38.0/150: 25% focus raid_movement, bullseye(29), rapid_killing, trueshot, potion_of_deadly_grace
5:49.057 sidewinders Fluffy_Pillow 47.4/150: 32% focus raid_movement, bullseye(29), rapid_killing, trueshot, potion_of_deadly_grace
5:50.029 aimed_shot Fluffy_Pillow 112.4/150: 75% focus bullseye(30), rapid_killing, trueshot, potion_of_deadly_grace
5:51.321 windburst Fluffy_Pillow 79.5/150: 53% focus bullseye(30), rapid_killing, trueshot, potion_of_deadly_grace
5:52.291 aimed_shot Fluffy_Pillow 71.6/150: 48% focus bullseye(30), rapid_killing, trueshot, potion_of_deadly_grace
5:53.583 marked_shot Fluffy_Pillow 41.6/150: 28% focus bullseye(30), rapid_killing, trueshot, potion_of_deadly_grace
5:54.552 sidewinders Fluffy_Pillow 23.6/150: 16% focus bullseye(30), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
5:55.524 aimed_shot Fluffy_Pillow 88.7/150: 59% focus bullseye(30), rapid_killing, trueshot, potion_of_deadly_grace
5:56.815 aimed_shot Fluffy_Pillow 55.8/150: 37% focus bullseye(30), rapid_killing, trueshot, potion_of_deadly_grace
5:58.108 aimed_shot Fluffy_Pillow 72.8/150: 49% focus bullseye(30), lock_and_load, rapid_killing, trueshot, potion_of_deadly_grace
5:59.078 aimed_shot Fluffy_Pillow 87.9/150: 59% focus bullseye(30), rapid_killing, trueshot, potion_of_deadly_grace
6:00.370 marked_shot Fluffy_Pillow 54.9/150: 37% focus bullseye(30), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
6:01.341 blood_fury Fluffy_Pillow 40.0/150: 27% focus bullseye(30), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
6:01.341 Waiting 0.100 sec 40.0/150: 27% focus blood_fury, bullseye(30), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
6:01.441 sidewinders Fluffy_Pillow 41.6/150: 28% focus blood_fury, bullseye(30), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
6:02.579 aimed_shot Fluffy_Pillow 106.2/150: 71% focus blood_fury, bullseye(30), marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
6:03.872 aimed_shot Fluffy_Pillow 71.5/150: 48% focus blood_fury, bullseye(30), marking_targets, potion_of_deadly_grace
6:05.227 aimed_shot Fluffy_Pillow 86.5/150: 58% focus blood_fury, bullseye(30), marking_targets, potion_of_deadly_grace
6:07.036 marked_shot Fluffy_Pillow 53.5/150: 36% focus blood_fury, bullseye(30), marking_targets, potion_of_deadly_grace
6:08.391 Waiting 0.700 sec 38.6/150: 26% focus blood_fury, bullseye(30), marking_targets, potion_of_deadly_grace
6:09.091 sidewinders Fluffy_Pillow 43.3/150: 29% focus blood_fury, bullseye(30), marking_targets, potion_of_deadly_grace
6:10.696 aimed_shot Fluffy_Pillow 111.1/150: 74% focus blood_fury, bullseye(30), potion_of_deadly_grace
6:12.503 windburst Fluffy_Pillow 78.2/150: 52% focus blood_fury, bullseye(30), potion_of_deadly_grace
6:13.859 aimed_shot Fluffy_Pillow 73.2/150: 49% focus blood_fury, bullseye(30), potion_of_deadly_grace
6:15.667 aimed_shot Fluffy_Pillow 90.2/150: 60% focus blood_fury, bullseye(30), lock_and_load, potion_of_deadly_grace
6:17.025 aimed_shot Fluffy_Pillow 105.3/150: 70% focus bullseye(30)
6:18.833 Waiting 0.100 sec 72.3/150: 48% focus bullseye(30)
6:18.933 marked_shot Fluffy_Pillow 73.4/150: 49% focus bullseye(30)
6:20.291 Waiting 0.900 sec 55.5/150: 37% focus raid_movement, bullseye(30), lock_and_load(2)
6:21.191 aimed_shot Fluffy_Pillow 65.5/150: 44% focus bullseye(30), lock_and_load(2)
6:22.547 aimed_shot Fluffy_Pillow 80.5/150: 54% focus bullseye(30), lock_and_load
6:23.904 sidewinders Fluffy_Pillow 92.6/150: 62% focus bullseye(30), marking_targets
6:25.261 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bullseye(30)
6:27.068 aimed_shot Fluffy_Pillow 100.0/150: 67% focus bullseye(30), marking_targets
6:28.875 Waiting 0.100 sec 67.1/150: 45% focus bullseye(30), marking_targets
6:28.975 marked_shot Fluffy_Pillow 68.2/150: 45% focus bullseye(30), marking_targets
6:30.331 aimed_shot Fluffy_Pillow 53.2/150: 35% focus bullseye(30), marking_targets
6:32.139 sidewinders Fluffy_Pillow 20.3/150: 14% focus bullseye(30), marking_targets
6:33.495 marked_shot Fluffy_Pillow 82.3/150: 55% focus bullseye(30)
6:34.851 windburst Fluffy_Pillow 67.3/150: 45% focus bullseye(30)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6234 6234 0
Agility 24663 23298 13162 (8757)
Stamina 33802 33802 21166
Intellect 6003 6003 0
Spirit 2 2 0
Health 2028120 2028120 0
Focus 150 150 0
Crit 22.35% 22.35% 2574
Haste 10.87% 10.87% 3532
Damage / Heal Versatility 1.94% 1.94% 775
Attack Power 24663 23298 0
Mastery 26.39% 26.39% 11980
Armor 2585 2585 2585
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 858.00
Local Head Greyed Dragonscale Coif
ilevel: 870, stats: { 358 Armor, +2344 Sta, +1563 AgiInt, +794 Mastery, +613 Crit }
Local Neck Wolfstride Pendant
ilevel: 850, stats: { +1094 Sta, +1311 Mastery, +525 Haste }, enchant: mark_of_the_hidden_satyr
Local Shoulders Matted Fur Pauldrons
ilevel: 850, stats: { 310 Armor, +1459 Sta, +973 AgiInt, +574 Crit, +406 Mastery }
Local Shirt Wraps of the Blood-Soaked Brawler
ilevel: 1
Local Chest Mountainforged Chain Hauberk
ilevel: 850, stats: { 414 Armor, +1945 Sta, +1297 AgiInt, +654 Haste, +654 Mastery }
Local Waist Roar of the Seven Lions
ilevel: 895, stats: { 268 Armor, +2219 Sta, +1479 Agi, +662 Haste, +496 Mastery }
Local Legs Leggings of Biting Links
ilevel: 855, stats: { 368 Armor, +2038 Sta, +1359 AgiInt, +921 Mastery, +409 Vers }
Local Feet Whelp Handler's Lined Boots
ilevel: 845, stats: { 280 Armor, +929 AgiInt, +1393 Sta, +604 Mastery, +357 Haste }
Local Wrists Ley Dragoon's Wristbraces
ilevel: 865, stats: { 190 Armor, +839 AgiInt, +1258 Sta, +505 Mastery, +272 Haste }
Local Hands Ley Dragoon's Gloves
ilevel: 860, stats: { 267 Armor, +1068 AgiInt, +1601 Sta, +595 Mastery, +421 Haste }
Local Finger1 Empowered Ring of the Kirin Tor
ilevel: 850, stats: { +1094 Sta, +1180 Mastery, +655 Crit }, enchant: { +150 Mastery }
Local Finger2 Nightborne Signet Ring
ilevel: 855, stats: { +1147 Sta, +1230 Mastery, +641 Haste }, enchant: { +200 Mastery }
Local Trinket1 Naraxas' Spiked Tongue
ilevel: 860, stats: { +968 Mastery }
Local Trinket2 Mana Crystal Shard
ilevel: 840, stats: { +1123 Agi, +898 Mastery }
Local Back Cape of Valarjar Courage
ilevel: 850, stats: { 130 Armor, +729 StrAgiInt, +1094 Sta, +366 Mastery, +366 Vers }, enchant: { +150 Agi }
Local Main Hand Thas'dorah, Legacy of the Windrunners
ilevel: 876, weapon: { 8908 - 8909, 3 }, stats: { +1653 Agi, +2480 Sta, +732 Crit, +702 Mastery }, relics: { +43 ilevels, +40 ilevels, +43 ilevels }

Talents

Level
15 Lone Wolf (Marksmanship Hunter) Steady Focus (Marksmanship Hunter) Careful Aim (Marksmanship Hunter)
30 Lock and Load (Marksmanship Hunter) Black Arrow (Marksmanship Hunter) True Aim (Marksmanship Hunter)
45 Posthaste Farstrider Trailblazer
60 Explosive Shot (Marksmanship Hunter) Sentinel (Marksmanship Hunter) Patient Sniper (Marksmanship Hunter)
75 Binding Shot Wyvern Sting Camouflage (Marksmanship Hunter)
90 A Murder of Crows Barrage Volley
100 Sidewinders (Marksmanship Hunter) Piercing Shot (Marksmanship Hunter) Trick Shot (Marksmanship Hunter)

Profile

hunter="Sarkul"
origin="https://us.api.battle.net/wow/character/thrall/Sarkul/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/171/133787819-avatar.jpg"
level=110
race=orc
role=attack
position=ranged_back
professions=engineering=707/leatherworking=800
talents=1113131
artifact=55:0:0:0:0:307:1:308:1:310:1:311:1:312:3:313:3:314:1:315:3:318:3:319:3:320:3:321:1:322:1:1337:1
spec=marksmanship

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=fishbrul_special
actions.precombat+=/summon_pet
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/volley
actions.precombat+=/windburst

# Executed every time the actor is available.
actions=auto_shot
actions+=/arcane_torrent,if=focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
actions+=/blood_fury
actions+=/berserking
actions+=/auto_shot
actions+=/variable,name=vulnerable_time,value=debuff.vulnerability.remains
actions+=/call_action_list,name=open,if=time<=15&talent.sidewinders.enabled&active_enemies=1
actions+=/call_action_list,name=cooldowns
actions+=/a_murder_of_crows,if=debuff.hunters_mark.down
actions+=/call_action_list,name=trueshotaoe,if=active_enemies>1&!talent.sidewinders.enabled&buff.trueshot.up
actions+=/barrage,if=debuff.hunters_mark.down
actions+=/black_arrow,if=debuff.hunters_mark.down
actions+=/a_murder_of_crows,if=(target.health.pct>30|target.health.pct<=20)&variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>60&focus+(focus.regen*debuff.hunters_mark.remains)>=60
actions+=/barrage,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>90&focus+(focus.regen*debuff.hunters_mark.remains)>=90
actions+=/black_arrow,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>70&focus+(focus.regen*debuff.hunters_mark.remains)>=70
actions+=/piercing_shot,if=!talent.patient_sniper.enabled&focus>50
actions+=/windburst,if=(!talent.patient_sniper.enabled|talent.sidewinders.enabled)&(debuff.hunters_mark.down|debuff.hunters_mark.remains>execute_time&focus+(focus.regen*debuff.hunters_mark.remains)>50)
actions+=/windburst,if=talent.patient_sniper.enabled&!talent.sidewinders.enabled&((debuff.vulnerability.down|debuff.vulnerability.remains<2)|(debuff.hunters_mark.up&buff.marking_targets.up&debuff.vulnerability.down))
actions+=/call_action_list,name=targetdie,if=target.time_to_die<6&active_enemies=1
actions+=/sidewinders,if=(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
actions+=/sentinel,if=debuff.hunters_mark.down&(buff.marking_targets.down|buff.trueshot.up)
actions+=/marked_shot,target=2,if=!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
actions+=/arcane_shot,if=!talent.patient_sniper.enabled&spell_targets.barrage=1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
actions+=/multishot,if=!talent.patient_sniper.enabled&spell_targets.barrage>1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
actions+=/arcane_shot,if=talent.steady_focus.enabled&spell_targets.barrage=1&(buff.steady_focus.down|buff.steady_focus.remains<2)
actions+=/multishot,if=talent.steady_focus.enabled&spell_targets.barrage>1&(buff.steady_focus.down|buff.steady_focus.remains<2)
actions+=/explosive_shot
actions+=/marked_shot,if=!talent.patient_sniper.enabled|(talent.barrage.enabled&spell_targets.barrage>2)
actions+=/aimed_shot,if=debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
actions+=/aimed_shot,if=debuff.hunters_mark.down&debuff.vulnerability.remains>execute_time&(talent.sidewinders.enabled|buff.marking_targets.down|(debuff.hunters_mark.remains>execute_time+gcd&focus+5+focus.regen*debuff.hunters_mark.remains>80))
actions+=/marked_shot,if=debuff.hunters_mark.remains<1|variable.vulnerable_time<1|spell_targets.barrage>1|buff.trueshot.up
actions+=/marked_shot,if=buff.marking_targets.up&(!talent.sidewinders.enabled|cooldown.sidewinders.charges_fractional>=1.2)
actions+=/sidewinders,if=buff.marking_targets.up&debuff.hunters_mark.down&(focus<=80|(variable.vulnerable_time<2&cooldown.windburst.remains>3&cooldown.sidewinders.charges_fractional>=1.2))
actions+=/piercing_shot,if=talent.patient_sniper.enabled&focus>80
actions+=/arcane_shot,if=spell_targets.barrage=1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
actions+=/multishot,if=spell_targets.barrage>1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
actions+=/aimed_shot,if=debuff.vulnerability.down&focus>80&cooldown.windburst.remains>3
actions+=/multishot,if=spell_targets.barrage>2

actions.cooldowns=potion,name=deadly_grace,if=(buff.trueshot.react&buff.bloodlust.react)|buff.bullseye.react>=23|target.time_to_die<31
actions.cooldowns+=//trueshot,if=buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16

actions.open=a_murder_of_crows
actions.open+=/trueshot
actions.open+=/sidewinders,if=(buff.marking_targets.down&buff.trueshot.remains<2)|(charges_fractional>=1.9&focus<80)
actions.open+=/marked_shot
actions.open+=/aimed_shot,if=buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
actions.open+=/black_arrow
actions.open+=/barrage
actions.open+=/aimed_shot,if=execute_time<debuff.vulnerability.remains
actions.open+=/sidewinders
actions.open+=/aimed_shot
actions.open+=/arcane_shot

actions.targetdie=marked_shot
actions.targetdie+=/windburst
actions.targetdie+=/aimed_shot,if=execute_time<debuff.vulnerability.remains
actions.targetdie+=/sidewinders
actions.targetdie+=/aimed_shot
actions.targetdie+=/arcane_shot

actions.trueshotaoe=marked_shot
actions.trueshotaoe+=/piercing_shot
actions.trueshotaoe+=/barrage
actions.trueshotaoe+=/explosive_shot
actions.trueshotaoe+=/aimed_shot,if=active_enemies=2&buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
actions.trueshotaoe+=/multishot

head=greyed_dragonscale_coif,id=139214,bonus_id=1807/1492/3337
neck=wolfstride_pendant,id=133633,bonus_id=1727/1502/3336,enchant=mark_of_the_hidden_satyr
shoulders=matted_fur_pauldrons,id=139217,bonus_id=1807/1472
back=cape_of_valarjar_courage,id=133765,bonus_id=3412/1502/1813,enchant=150agi
chest=mountainforged_chain_hauberk,id=139597
shirt=wraps_of_the_bloodsoaked_brawler,id=98543
wrists=ley_dragoons_wristbraces,id=134296,bonus_id=3414/1527/3336
hands=ley_dragoons_gloves,id=134297,bonus_id=3397/1522/3337
waist=roar_of_the_seven_lions,id=137080,bonus_id=1811
legs=leggings_of_biting_links,id=137518,bonus_id=1727/1507/3337
feet=whelp_handlers_lined_boots,id=134464,bonus_id=3411/1497/1813
finger1=empowered_ring_of_the_kirin_tor,id=139599,enchant=150mastery
finger2=nightborne_signet_ring,id=134279,bonus_id=3432/1517/3337,enchant=200mastery
trinket1=naraxas_spiked_tongue,id=137349,bonus_id=3412/1512/3336
trinket2=mana_crystal_shard,id=134335,bonus_id=3432/605/1502/3336
main_hand=thasdorah_legacy_of_the_windrunners,id=128826,bonus_id=727,gem_id=137008/137302/136973/0,relic_id=1807:1472/1727:1492:1813/1727:1502:3336/0

# Gear Summary
# gear_ilvl=858.07
# gear_agility=13162
# gear_stamina=21166
# gear_crit_rating=2574
# gear_haste_rating=3532
# gear_mastery_rating=11980
# gear_versatility_rating=775
# gear_armor=2585
summon_pet=cat

Zipi

Zipi : 418130 dps, 251515 dps to main target

  • Race: Tauren
  • Class: Paladin
  • Spec: Retribution
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
418130.4 418130.4 436.7 / 0.104% 83950.1 / 20.1% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 12.01% 54.9 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Zipi/advanced
Talents
  • 15: Execution Sentence (Retribution Paladin)
  • 30: Zeal (Retribution Paladin)
  • 45: Blinding Light
  • 60: Virtue's Blade (Retribution Paladin)
  • 75: Eye for an Eye (Retribution Paladin)
  • 90: Cavalier (Retribution Paladin)
  • 100: Holy Wrath (Retribution Paladin)
  • Talent Calculator
Artifact
Professions
  • mining: 616
  • herbalism: 486
Scale Factors for Zipi Damage Per Second
Str Vers Crit Haste Mastery
Scale Factors 12.26 10.67 10.55 7.73 5.72
Normalized 1.00 0.87 0.86 0.63 0.47
Scale Deltas 1138 1138 1138 1138 1138
Error 0.55 0.55 0.55 0.55 0.55
Gear Ranking
Optimizers
Ranking
  • Str > Vers ~= Crit > Haste > Mastery
Pawn string ( Pawn: v1: "Zipi": Strength=12.26, CritRating=10.55, HasteRating=7.73, MasteryRating=5.72, Versatility=10.67 )

Scale Factors for other metrics

Scale Factors for Zipi Damage Per Second
Str Vers Crit Haste Mastery
Scale Factors 12.26 10.67 10.55 7.73 5.72
Normalized 1.00 0.87 0.86 0.63 0.47
Scale Deltas 1138 1138 1138 1138 1138
Error 0.55 0.55 0.55 0.55 0.55
Gear Ranking
Optimizers
Ranking
  • Str > Vers ~= Crit > Haste > Mastery
Pawn string ( Pawn: v1: "Zipi": Strength=12.26, CritRating=10.55, HasteRating=7.73, MasteryRating=5.72, Versatility=10.67 )
Scale Factors for Zipi Priority Target Damage Per Second
Str Crit Vers Haste Mastery
Scale Factors 7.32 6.72 6.52 6.36 4.30
Normalized 1.00 0.92 0.89 0.87 0.59
Scale Deltas 1138 1138 1138 1138 1138
Error 0.17 0.17 0.17 0.17 0.17
Gear Ranking
Optimizers
Ranking
  • Str > Crit > Vers ~= Haste > Mastery
Pawn string ( Pawn: v1: "Zipi": Strength=7.32, CritRating=6.72, HasteRating=6.36, MasteryRating=4.30, Versatility=6.52 )
Scale Factors for Zipi Damage Per Second (Effective)
Str Vers Crit Haste Mastery
Scale Factors 12.26 10.67 10.55 7.73 5.72
Normalized 1.00 0.87 0.86 0.63 0.47
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Str > Vers > Crit > Haste > Mastery
Pawn string ( Pawn: v1: "Zipi": Strength=12.26, CritRating=10.55, HasteRating=7.73, MasteryRating=5.72, Versatility=10.67 )
Scale Factors for Zipi Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )
Scale Factors for Zipi Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )
Scale Factors for Zipi Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )
Scale Factors for Zipi Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )
Scale Factors for Zipi Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )
Scale Factors for Zipi Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )
Scale Factors for Zipi Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )
Scale Factors for ZipiTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Zipi 418130
Blade of Justice 35218 8.5% 51.3 7.83sec 275064 263003 Direct 51.3 181886 560067 275062 24.6%  

Stats details: blade_of_justice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.33 51.33 0.00 0.00 1.0459 0.0000 14117990.65 20754783.54 31.98 263002.81 263002.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.68 75.36% 181886.31 158088 243245 181873.52 168736 195576 7035464 10342798 31.98
crit 12.65 24.64% 560066.90 486911 749195 559962.31 490184 685059 7082527 10411986 31.98
 
 

Action details: blade_of_justice

Static Values
  • id:184575
  • school:physical
  • resource:none
  • range:12.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
Spelldata
  • id:184575
  • name:Blade of Justice
  • school:physical
  • tooltip:
  • description:Strikes an enemy with the Blade of Justice, dealing ${$sw2*$<mult>} Physical damage. |cFFFFFFFFGenerates {$s3=2} Holy Power.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.50
 
Greater Blessing of Might (blessing_of_might_proc) 31664 7.6% 372.1 1.99sec 33921 0 Direct 277.1 45550 0 45550 0.0%  

Stats details: blessing_of_might_proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 372.09 277.09 0.00 0.00 0.0000 0.0000 12621575.38 12621575.38 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 277.09 100.00% 45549.55 6347 1024743 45518.74 36403 58656 12621575 12621575 0.00
 
 

Action details: blessing_of_might_proc

Static Values
  • id:205729
  • school:holy
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205729
  • name:Greater Blessing of Might
  • school:holy
  • tooltip:
  • description:{$@spelldesc203528=Places a blessing on an ally that gives their attacks a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy. You may only have 3 Greater Blessings active at one time.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:29645.36
  • base_dd_max:29645.36
 
Divine Storm 108252 25.7% 44.6 6.52sec 958639 904160 Direct 267.7 127296 259427 159773 24.6%  

Stats details: divine_storm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.62 267.73 0.00 0.00 1.0603 0.0000 42776732.05 42776732.05 0.00 904160.39 904160.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 201.93 75.42% 127296.03 101230 209029 127301.19 122193 131819 25704490 25704490 0.00
crit 65.81 24.58% 259427.16 206510 426419 259441.69 235503 288122 17072242 17072242 0.00
 
 

Action details: divine_storm

Static Values
  • id:53385
  • school:holy
  • resource:holy_power
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:3.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
Spelldata
  • id:53385
  • name:Divine Storm
  • school:holy
  • tooltip:
  • description:Unleashes a whirl of divine energy, dealing $224239sw1 Holy damage to all nearby enemies.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Execution Sentence 23496 5.7% 17.0 24.48sec 558732 523583 Periodic 16.7 452644 920727 568655 24.8% 20.5%

Stats details: execution_sentence

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.99 0.00 16.69 16.69 1.0672 4.9180 9491513.76 9491513.76 0.00 94710.56 523583.06
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.6 75.22% 452643.83 307242 627652 452629.70 394186 536835 5682788 5682788 0.00
crit 4.1 24.78% 920726.54 626774 1280411 910118.14 0 1280411 3808726 3808726 0.00
 
 

Action details: execution_sentence

Static Values
  • id:213757
  • school:holy
  • resource:holy_power
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:3.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.divine_storm<=3&(cooldown.judgment.remains<gcd*4.5|debuff.judgment.remains>gcd*4.67)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)
Spelldata
  • id:213757
  • name:Execution Sentence
  • school:holy
  • tooltip:Taking $s2 Holy damage when this expires.
  • description:A hammer slowly falls from the sky, dealing $s2 Holy damage after {$d=7 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:11.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:7.00
  • base_tick_time:7.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Judgment 23532 5.7% 45.1 8.90sec 209056 197202 Direct 45.1 166510 339427 209092 24.6%  

Stats details: judgment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.11 45.11 0.00 0.00 1.0601 0.0000 9431359.72 9431359.72 0.00 197201.52 197201.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.00 75.37% 166510.46 145616 224916 166519.07 155980 177116 5661026 5661026 0.00
crit 11.11 24.63% 339426.99 297056 458829 339402.00 298964 454950 3770334 3770334 0.00
 
 

Action details: judgment

Static Values
  • id:20271
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:
  • description:Judges the target{$?s218178=false}[ and up to ${{$231661s1=1}+{$218178s2=2}} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing {$s1=0} Holy damage{$?s76672=false}|a231663[, and causing them to take {$197277s1=0}% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by {$231657s1=2} sec, or ${{$231657s1=2}*2} sec on a critical strike][].
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Judgment (_aoe) 11540 2.7% 45.1 8.90sec 101095 0 Direct 23.0 157766 322169 198281 24.6%  

Stats details: judgment_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.11 23.00 0.00 0.00 0.0000 0.0000 4559966.34 4559966.34 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.33 75.35% 157766.13 135657 208996 157765.52 139192 176014 2733863 2733863 0.00
crit 5.67 24.65% 322169.19 276741 426352 321641.03 0 426352 1826103 1826103 0.00
 
 

Action details: judgment_aoe

Static Values
  • id:228288
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:228288
  • name:Judgment
  • school:holy
  • tooltip:
  • description:{$@spelldesc20271=Judges the target{$?s218178=false}[ and up to ${{$231661s1=1}+{$218178s2=2}} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing {$s1=0} Holy damage{$?s76672=false}|a231663[, and causing them to take {$197277s1=0}% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by {$231657s1=2} sec, or ${{$231657s1=2}*2} sec on a critical strike][].}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
melee 12328 3.0% 120.7 3.32sec 41029 16665 Direct 120.7 32682 66674 41028 24.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 120.67 120.67 0.00 0.00 2.4620 0.0000 4950754.54 7278078.12 31.98 16664.55 16664.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 91.04 75.45% 32682.49 27522 43558 32685.49 31251 34183 2975401 4374121 31.98
crit 29.63 24.55% 66674.15 56144 88858 66678.20 59157 76082 1975354 2903957 31.98
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Potion of the Old War 15240 3.6% 29.2 5.34sec 205946 0 Direct 29.2 163871 334116 205951 24.7%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.24 29.24 0.00 0.00 0.0000 0.0000 6020972.13 8851399.36 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.01 75.29% 163871.02 117301 178885 163870.39 151836 173887 3606880 5302455 31.98
crit 7.23 24.71% 334116.32 239295 364925 333997.16 247670 364925 2414093 3548945 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
shield_of_vengeance_proc 9808 2.4% 3.8 119.63sec 1033505 0 Direct 3.7 852583 1737970 1070780 24.6%  

Stats details: shield_of_vengeance_proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.79 3.66 0.00 0.00 0.0000 0.0000 3918410.33 3918410.33 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.76 75.36% 852583.18 566987 1674417 848880.74 0 1674417 2351157 2351157 0.00
crit 0.90 24.64% 1737970.46 1156654 3415812 1114910.93 0 3415812 1567253 1567253 0.00
 
 

Action details: shield_of_vengeance_proc

Static Values
  • id:184689
  • school:holy
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1139588.76
  • base_dd_max:1139588.76
 
Templar's Verdict 27337 6.7% 32.2 12.57sec 345561 325500 Direct 32.2 275219 561369 345558 24.6%  

Stats details: templars_verdict

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.20 32.20 0.00 0.00 1.0617 0.0000 11128190.94 11128190.94 0.00 325499.91 325499.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.29 75.42% 275218.95 246645 376133 275389.28 250669 305434 6684282 6684282 0.00
crit 7.92 24.58% 561368.93 503155 767312 560914.45 0 767312 4443909 4443909 0.00
 
 

Action details: templars_verdict

Static Values
  • id:85256
  • school:holy
  • resource:holy_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:3.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
Spelldata
  • id:85256
  • name:Templar's Verdict
  • school:holy
  • tooltip:
  • description:A powerful weapon strike that deals ${$224266sw1*$<mult>} Holy damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Wake of Ashes 43312 10.3% 13.0 32.24sec 1325805 1225283 Direct 38.1 213494 435820 268230 24.6%  
Periodic 178.1 31156 63553 39129 24.6% 44.4%

Stats details: wake_of_ashes

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.97 38.13 178.13 178.13 1.0821 1.0000 17198070.69 17198070.69 0.00 89494.98 1225282.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.74 75.38% 213493.57 172343 276869 213541.01 197268 230276 6136318 6136318 0.00
crit 9.39 24.62% 435819.77 351580 564812 435972.62 365671 564812 4091660 4091660 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 134.3 75.39% 31156.32 29166 46854 31155.58 30819 31650 4184117 4184117 0.00
crit 43.8 24.61% 63553.12 59498 95583 63552.48 62368 65694 2785976 2785976 0.00
 
 

Action details: wake_of_ashes

Static Values
  • id:205273
  • school:holyfire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power>=0&time<2
Spelldata
  • id:205273
  • name:Wake of Ashes
  • school:holyfire
  • tooltip:Movement speed reduced by {$s2=50}%. $?$w3!=0[Suffering {$s3=0} Radiant damage every $t3 sec][]
  • description:Lash out with the |cFFFFCC99Ashbringer|r, dealing $sw1 Radiant damage$?a179546[, and an additional $o3 Radiant damage over {$d=6 seconds},][] to all enemies within $a1 yd in front of you, and reducing movement speed by {$s2=50}% for {$d=6 seconds}. Demon and Undead enemies are stunned for {$205290d=6 seconds} if struck by the Wake of Ashes.$?a179546[ |cFFFFFFFFGenerates {$218001s1=5} Holy Power.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:6.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.100000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Zeal 76403 18.3% 120.4 3.32sec 252922 238174 Direct 296.8 71151 145116 102620 42.5%  

Stats details: zeal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 120.42 296.79 0.00 0.00 1.0619 0.0000 30456952.45 44774605.07 31.98 238173.81 238173.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 170.52 57.45% 71150.83 21155 150697 71064.46 61418 80567 12132687 17836199 31.98
crit 126.27 42.55% 145115.53 43156 307422 144939.60 121483 167621 18324266 26938406 31.98
 
 

Action details: zeal

Static Values
  • id:217020
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.18
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=2&holy_power<=4
Spelldata
  • id:217020
  • name:Zeal
  • school:physical
  • tooltip:Chains to an additonal nearby target per stack.
  • description:Strike the target for $sw2 Physical damage. Maximum {$s5=2} charges. Grants Zeal, causing Zeal attacks to chain to an additional nearby target per stack. Maximum {$u=3} stacks. Each jump deals {$s6=40}% less damage. |cFFFFFFFFGenerates {$s3=1} Holy Power.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.20
 
Simple Action Stats Execute Interval
Zipi
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zipi
  • harmful:false
  • if_expr:
 
Crusade 3.6 128.48sec

Stats details: crusade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 3.58 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: crusade

Static Values
  • id:231895
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zipi
  • harmful:false
  • if_expr:holy_power>=5
Spelldata
  • id:231895
  • name:Crusade
  • school:holy
  • tooltip:Damage and haste increased by ${{$s1=35}/10}.1%.
  • description:Increases your damage and haste by ${{$s1=35}/10}.1% for {$d=20 seconds}. Each Holy Power spent during Crusade increases damage and haste by an additional ${{$s1=35}/10}.1%. Maximum {$u=15} stacks.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zipi
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zipi
  • harmful:false
  • if_expr:
 
Greater Blessing of Might 1.0 0.00sec

Stats details: greater_blessing_of_might

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: greater_blessing_of_might

Static Values
  • id:203528
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zipi
  • harmful:false
  • if_expr:
Spelldata
  • id:203528
  • name:Greater Blessing of Might
  • school:holy
  • tooltip:Attacks have a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy.
  • description:Places a blessing on an ally that gives their attacks a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy. You may only have 3 Greater Blessings active at one time.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shield of Vengeance 3.8 120.00sec

Stats details: shield_of_vengeance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 3.79 3.79 0.00 0.00 0.0000 0.0000 0.00 2624345.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.86 75.40% 0.00 0 0 0.00 0 0 0 1575440 99.46
crit 0.93 24.60% 0.00 0 0 0.00 0 0 0 1048905 65.45
 
 

Action details: shield_of_vengeance

Static Values
  • id:184662
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zipi
  • harmful:false
  • if_expr:
Spelldata
  • id:184662
  • name:Shield of Vengeance
  • school:holy
  • tooltip:Absorbs $w1 damage and deals damage when fully consumed.
  • description:Creates a barrier of holy light that absorbs ${$AP*10} damage for {$d=15 seconds}. When the barrier is consumed, all damage absorbed is dealt as Holy damage divided across all enemies within $184689A1 yds.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.12% 31.62% 0.0(0.0) 1.0

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Chaotic Energy 1.0 119.7 0.0sec 3.3sec 99.39% 99.39% 100.7(100.7) 0.0

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_chaotic_energy
  • max_stacks:20
  • duration:23.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:66.50

Stack Uptimes

  • chaotic_energy_1:0.48%
  • chaotic_energy_2:0.48%
  • chaotic_energy_3:0.44%
  • chaotic_energy_4:0.41%
  • chaotic_energy_5:0.38%
  • chaotic_energy_6:0.99%
  • chaotic_energy_7:0.36%
  • chaotic_energy_8:0.36%
  • chaotic_energy_9:0.36%
  • chaotic_energy_10:1.45%
  • chaotic_energy_11:0.36%
  • chaotic_energy_12:0.36%
  • chaotic_energy_13:0.70%
  • chaotic_energy_14:0.36%
  • chaotic_energy_15:0.55%
  • chaotic_energy_16:0.55%
  • chaotic_energy_17:0.55%
  • chaotic_energy_18:0.55%
  • chaotic_energy_19:0.70%
  • chaotic_energy_20:88.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:214831
  • name:Chaotic Energy
  • tooltip:Strength or Agility increased by $w3.
  • description:{$@spelldesc214829=Your melee autoattacks grant you Chaotic Energy, increasing your Strength or Agility by {$214831s3=50}, stacking up to {$214831u=20} times. If you do not autoattack an enemy for 4 sec, this effect will decrease by 1 stack every sec.}
  • max_stacks:20
  • duration:23.00
  • cooldown:0.00
  • default_chance:101.00%
Crusade 3.6 30.9 128.5sec 10.7sec 26.09% 100.00% 16.8(43.3) 3.4

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_crusade
  • max_stacks:15
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • crusade_1:0.51%
  • crusade_4:2.67%
  • crusade_7:3.40%
  • crusade_10:2.75%
  • crusade_13:4.12%
  • crusade_15:12.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:231895
  • name:Crusade
  • tooltip:Damage and haste increased by ${{$s1=35}/10}.1%.
  • description:Increases your damage and haste by ${{$s1=35}/10}.1% for {$d=20 seconds}. Each Holy Power spent during Crusade increases damage and haste by an additional ${{$s1=35}/10}.1%. Maximum {$u=15} stacks.
  • max_stacks:15
  • duration:20.00
  • cooldown:20.00
  • default_chance:100.00%
Potion of the Old War 2.0 0.0 129.3sec 0.0sec 12.15% 12.15% 0.0(0.0) 2.0

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 14.53% 14.53% 2.0(2.0) 0.0

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.53%

Trigger Attempt Success

  • trigger_pct:100.00%
Shield of Vengeance 3.8 0.0 120.0sec 120.0sec 13.95% 13.95% 0.0(0.0) 3.7

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_shield_of_vengeance
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • shield_of_vengeance_1:13.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:184662
  • name:Shield of Vengeance
  • tooltip:Absorbs $w1 damage and deals damage when fully consumed.
  • description:Creates a barrier of holy light that absorbs ${$AP*10} damage for {$d=15 seconds}. When the barrier is consumed, all damage absorbed is dealt as Holy damage divided across all enemies within $184689A1 yds.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:101.00%
Zeal 1.0 119.4 0.0sec 3.3sec 99.49% 99.16% 117.4(117.4) 0.0

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_zeal
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • zeal_1:0.81%
  • zeal_2:0.19%
  • zeal_3:98.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:217020
  • name:Zeal
  • tooltip:Chains to an additonal nearby target per stack.
  • description:Strike the target for $sw2 Physical damage. Maximum {$s5=2} charges. Grants Zeal, causing Zeal attacks to chain to an additional nearby target per stack. Maximum {$u=3} stacks. Each jump deals {$s6=40}% less damage. |cFFFFFFFFGenerates {$s3=1} Holy Power.
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Greater Blessing of Might (blessing_of_might)

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_blessing_of_might
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • blessing_of_might_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:203528
  • name:Greater Blessing of Might
  • tooltip:Attacks have a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy.
  • description:Places a blessing on an ally that gives their attacks a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy. You may only have 3 Greater Blessings active at one time.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Zipi
divine_storm Holy Power 44.6 133.9 3.0 3.0 319545.9
execution_sentence Holy Power 17.0 51.0 3.0 3.0 186243.9
templars_verdict Holy Power 32.2 96.6 3.0 3.0 115187.4
Resource Gains Type Count Total Average Overflow
wake_of_ashes Holy Power 12.97 60.79 (21.42%) 4.69 4.07 6.27%
zeal Holy Power 120.42 120.42 (42.42%) 1.00 0.00 0.00%
blade_of_justice Holy Power 51.33 102.65 (36.16%) 2.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Holy Power 0.71 0.70
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Holy Power 2.42 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Zipi Fight Length
Count 9999
Mean 401.00
Minimum 308.02
Maximum 501.87
Spread ( max - min ) 193.85
Range [ ( max - min ) / 2 * 100% ] 24.17%
DPS
Sample Data Zipi Damage Per Second
Count 9999
Mean 418130.44
Minimum 360302.71
Maximum 486507.77
Spread ( max - min ) 126205.06
Range [ ( max - min ) / 2 * 100% ] 15.09%
Standard Deviation 22277.3638
5th Percentile 385167.11
95th Percentile 458605.66
( 95th Percentile - 5th Percentile ) 73438.55
Mean Distribution
Standard Deviation 222.7848
95.00% Confidence Intervall ( 417693.79 - 418567.09 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 109
0.1% Error 10904
0.1 Scale Factor Error with Delta=300 4236539
0.05 Scale Factor Error with Delta=300 16946158
0.01 Scale Factor Error with Delta=300 423653952
Priority Target DPS
Sample Data Zipi Priority Target Damage Per Second
Count 9999
Mean 251514.52
Minimum 227923.45
Maximum 279796.79
Spread ( max - min ) 51873.34
Range [ ( max - min ) / 2 * 100% ] 10.31%
Standard Deviation 6965.5038
5th Percentile 240471.73
95th Percentile 263283.11
( 95th Percentile - 5th Percentile ) 22811.38
Mean Distribution
Standard Deviation 69.6585
95.00% Confidence Intervall ( 251378.00 - 251651.05 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 29
0.1% Error 2946
0.1 Scale Factor Error with Delta=300 414179
0.05 Scale Factor Error with Delta=300 1656718
0.01 Scale Factor Error with Delta=300 41417962
DPS(e)
Sample Data Zipi Damage Per Second (Effective)
Count 9999
Mean 418130.44
Minimum 360302.71
Maximum 486507.77
Spread ( max - min ) 126205.06
Range [ ( max - min ) / 2 * 100% ] 15.09%
Damage
Sample Data Zipi Damage
Count 9999
Mean 166672488.97
Minimum 139103726.32
Maximum 195601011.35
Spread ( max - min ) 56497285.03
Range [ ( max - min ) / 2 * 100% ] 16.95%
DTPS
Sample Data Zipi Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Zipi Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Zipi Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Zipi Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Zipi Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Zipi Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data ZipiTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Zipi Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_countless_armies
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 greater_blessing_of_might
4 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
5 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
6 32.73 auto_attack
0.00 rebuke
7 1.00 potion,name=old_war,if=(buff.bloodlust.react|buff.avenging_wrath.up|buff.crusade.up|target.time_to_die<=40)
0.00 holy_wrath
0.00 avenging_wrath
8 3.79 shield_of_vengeance
9 3.58 crusade,if=holy_power>=5
A 1.00 wake_of_ashes,if=holy_power>=0&time<2
B 16.99 execution_sentence,if=spell_targets.divine_storm<=3&(cooldown.judgment.remains<gcd*4.5|debuff.judgment.remains>gcd*4.67)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)
0.00 blood_fury
0.00 berserking
0.00 arcane_torrent,if=holy_power<5
C 0.00 call_action_list,name=VB,if=talent.virtues_blade.enabled
D 0.00 call_action_list,name=DH,if=talent.divine_hammer.enabled
actions.VB
# count action,conditions
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&buff.divine_purpose.react
E 10.27 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
0.00 justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2&!equipped.whisper_of_the_nathrezim
0.00 justicars_vengeance,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
0.00 templars_verdict,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
0.00 templars_verdict,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react
F 12.81 templars_verdict,if=debuff.judgment.up&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
G 6.39 divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
0.00 justicars_vengeance,if=debuff.judgment.up&holy_power>=3&buff.divine_purpose.up&cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled&!equipped.whisper_of_the_nathrezim
H 3.78 templars_verdict,if=debuff.judgment.up&holy_power>=3&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
I 11.97 wake_of_ashes,if=holy_power=0|holy_power=1&cooldown.blade_of_justice.remains>gcd|holy_power=2&(cooldown.zeal.charges_fractional<=0.34|cooldown.crusader_strike.charges_fractional<=0.34)
J 23.27 zeal,if=charges=2&holy_power<=4
0.00 crusader_strike,if=charges=2&holy_power<=4
K 51.62 blade_of_justice,if=holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
L 45.12 judgment,if=holy_power>=3|((cooldown.zeal.charges_fractional<=1.67|cooldown.crusader_strike.charges_fractional<=1.67)&cooldown.blade_of_justice.remains>gcd)|(talent.greater_judgment.enabled&target.health.pct>50)
0.00 consecration
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.react
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
M 17.24 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=4&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
0.00 justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
0.00 templars_verdict,if=debuff.judgment.up&buff.divine_purpose.react
0.00 templars_verdict,if=debuff.judgment.up&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
N 11.93 templars_verdict,if=debuff.judgment.up&holy_power>=4&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
O 98.85 zeal,if=holy_power<=4
0.00 crusader_strike,if=holy_power<=4
P 10.73 divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)
Q 3.68 templars_verdict,if=debuff.judgment.up&holy_power>=3&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)

Sample Sequence

0123568A9BJKLFJONOKNLOOB6KOLQOKONLKP6JOLKMJ6OGIEJKLEJOMOKBLOO6OKFOOLM6OKMOOL6GIEJKEJLBJOKN6OLK6JEOOLMKG6IEJOLMKOBOOLKE6OOLMK8JGO6OLGI97FKBJOLONKO6MOLOKEOPLOKPOOLK6GOIBOOLNKONO6OKLEJOMOKLMO6OBILFJKFJP6J6OKLMOOPOKLOG6OIBKOLFOPK6OOL6MO8KMOOLPKOBI69FOLKFOP6OOKLMO6OKELOPKOPLOKBI6FLOKF6JOLMKOM6OOLKEOBOKL6HIFJONKLBJOOK6LFOONKOBLOK6HILFJKFJ8BOL6OKNOOLONKBO6I9LFJKFJONOLKBO

Sample Sequence Table

time name target resources buffs
Pre flask Zipi 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre food Zipi 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre augmentation Zipi 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre greater_blessing_of_might Zipi 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre potion Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power potion_of_the_old_war
0:00.000 shield_of_vengeance Zipi 220000.0/220000: 100% mana | 0.0/5: 0% holy_power potion_of_the_old_war
0:00.000 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power shield_of_vengeance, potion_of_the_old_war
0:01.140 crusade Zipi 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, shield_of_vengeance, potion_of_the_old_war
0:01.140 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade, shield_of_vengeance, potion_of_the_old_war
0:02.020 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(4), shield_of_vengeance, potion_of_the_old_war
0:02.819 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(4), zeal, shield_of_vengeance, chaotic_energy, potion_of_the_old_war
0:03.617 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(4), zeal, shield_of_vengeance, chaotic_energy, potion_of_the_old_war
0:04.416 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(4), zeal, shield_of_vengeance, chaotic_energy(2), potion_of_the_old_war
0:05.214 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(7), zeal, shield_of_vengeance, chaotic_energy(2), potion_of_the_old_war
0:05.968 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(7), zeal(2), shield_of_vengeance, chaotic_energy(2), potion_of_the_old_war
0:06.723 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(7), zeal(3), shield_of_vengeance, chaotic_energy(3), potion_of_the_old_war
0:07.478 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(10), zeal(3), shield_of_vengeance, chaotic_energy(3), potion_of_the_old_war
0:08.235 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(10), zeal(3), shield_of_vengeance, chaotic_energy(4), potion_of_the_old_war
0:09.138 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(10), zeal(3), shield_of_vengeance, chaotic_energy(4), potion_of_the_old_war
0:09.892 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(13), zeal(3), shield_of_vengeance, chaotic_energy(5), potion_of_the_old_war
0:10.730 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(13), zeal(3), shield_of_vengeance, chaotic_energy(5), potion_of_the_old_war
0:11.484 Waiting 0.100 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(13), zeal(3), shield_of_vengeance, chaotic_energy(6), potion_of_the_old_war
0:11.584 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(13), zeal(3), shield_of_vengeance, chaotic_energy(6), potion_of_the_old_war
0:12.519 Waiting 0.100 sec 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, raid_movement, crusade(13), zeal(3), shield_of_vengeance, chaotic_energy(6), potion_of_the_old_war
0:12.619 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, raid_movement, crusade(13), zeal(3), shield_of_vengeance, chaotic_energy(6), potion_of_the_old_war
0:13.567 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(15), zeal(3), shield_of_vengeance, chaotic_energy(6), potion_of_the_old_war
0:13.567 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(15), zeal(3), shield_of_vengeance, chaotic_energy(6), potion_of_the_old_war
0:14.321 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), zeal(3), shield_of_vengeance, chaotic_energy(6), potion_of_the_old_war
0:15.074 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(7), potion_of_the_old_war
0:15.829 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(7), potion_of_the_old_war
0:16.583 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(8), potion_of_the_old_war
0:17.337 Waiting 0.200 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(8), potion_of_the_old_war
0:17.537 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(8), potion_of_the_old_war
0:18.482 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(9), potion_of_the_old_war
0:19.235 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(9), potion_of_the_old_war
0:19.989 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(10), potion_of_the_old_war
0:20.745 Waiting 0.900 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, raid_movement, crusade(15), zeal(3), chaotic_energy(10), potion_of_the_old_war
0:21.645 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, raid_movement, crusade(15), zeal(3), chaotic_energy(10), potion_of_the_old_war
0:22.639 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, raid_movement, crusade(15), zeal(3), chaotic_energy(10), potion_of_the_old_war
0:23.394 Waiting 0.200 sec 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, raid_movement, crusade(15), zeal(3), chaotic_energy(10)
0:23.594 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(10)
0:23.594 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(10)
0:24.348 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(10)
0:25.105 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(11)
0:25.859 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(11)
0:26.798 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(12)
0:27.552 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(12)
0:28.307 Waiting 0.900 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, raid_movement, crusade(15), zeal(3), chaotic_energy(13)
0:29.207 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(13)
0:29.207 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(13)
0:29.960 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(13)
0:30.716 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(14)
0:31.471 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, zeal(3), chaotic_energy(14)
0:32.380 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, zeal(3), chaotic_energy(15)
0:33.290 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, zeal(3), chaotic_energy(15)
0:34.199 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, zeal(3), chaotic_energy(15)
0:35.110 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, zeal(3), chaotic_energy(16)
0:36.021 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, zeal(3), chaotic_energy(16)
0:36.930 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, zeal(3), chaotic_energy(17)
0:37.841 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, zeal(3), chaotic_energy(17)
0:38.751 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, zeal(3), chaotic_energy(18)
0:39.662 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, zeal(3), chaotic_energy(18)
0:40.573 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, zeal(3), chaotic_energy(18)
0:41.626 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(19)
0:42.810 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(19)
0:43.992 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
0:44.006 Waiting 1.200 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), chaotic_energy(20)
0:45.206 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
0:45.206 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
0:46.389 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
0:47.570 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
0:48.752 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
0:49.933 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
0:51.114 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power raid_movement, zeal(3), chaotic_energy(20)
0:52.296 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power raid_movement, zeal(3), chaotic_energy(20)
0:53.479 Waiting 0.100 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, zeal(3), chaotic_energy(20)
0:53.579 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
0:53.579 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
0:54.763 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
0:55.947 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
0:57.129 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
0:58.312 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
0:59.494 Waiting 0.800 sec 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:00.294 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement, zeal(3), chaotic_energy(20)
1:01.719 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:01.719 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:02.902 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
1:04.085 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
1:05.267 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:06.448 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:07.630 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
1:08.812 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:09.994 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:11.177 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:12.358 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
1:13.540 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
1:14.723 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:15.905 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
1:17.089 Waiting 0.100 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, zeal(3), chaotic_energy(20)
1:17.189 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
1:17.189 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
1:18.372 Waiting 0.800 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:19.172 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:20.600 Waiting 2.200 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), chaotic_energy(20)
1:22.800 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), chaotic_energy(20)
1:24.152 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
1:24.152 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
1:25.333 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
1:26.515 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:27.698 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:28.881 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
1:30.063 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
1:31.245 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
1:32.428 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement, zeal(3), chaotic_energy(20)
1:33.609 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
1:33.609 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
1:34.791 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
1:35.974 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:37.156 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:38.338 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
1:39.519 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
1:40.704 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
1:41.885 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:43.068 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
1:44.252 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
1:45.434 Waiting 0.900 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:46.334 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:47.760 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:48.945 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement, zeal(3), chaotic_energy(20)
1:50.131 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power raid_movement, zeal(3), chaotic_energy(20)
1:51.315 Waiting 2.300 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), chaotic_energy(20)
1:53.615 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:53.615 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:54.797 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:55.980 Waiting 1.000 sec 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
1:56.980 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
1:58.369 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
1:59.551 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
2:00.000 shield_of_vengeance Zipi 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
2:00.734 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
2:01.917 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
2:03.100 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
2:04.284 Waiting 0.900 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), shield_of_vengeance, chaotic_energy(20)
2:05.184 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
2:05.184 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
2:06.366 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
2:07.792 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
2:08.974 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
2:10.155 crusade Zipi 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
2:10.155 potion Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, zeal(3), shield_of_vengeance, chaotic_energy(20)
2:10.155 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, zeal(3), shield_of_vengeance, chaotic_energy(20), potion_of_the_old_war
2:11.297 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(4), zeal(3), shield_of_vengeance, chaotic_energy(20), potion_of_the_old_war
2:12.334 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(4), zeal(3), shield_of_vengeance, chaotic_energy(20), potion_of_the_old_war
2:13.371 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(7), zeal(3), shield_of_vengeance, chaotic_energy(20), potion_of_the_old_war
2:14.323 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(7), zeal(3), shield_of_vengeance, chaotic_energy(20), potion_of_the_old_war
2:15.274 Waiting 0.600 sec 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(7), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:15.874 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(7), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:16.985 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(7), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:17.937 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(7), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:18.888 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(10), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:19.765 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(10), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:20.641 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(10), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:20.641 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(10), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:21.517 Waiting 0.200 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(13), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:21.717 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(13), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:22.700 Waiting 0.700 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(13), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:23.400 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(13), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:24.416 Waiting 0.100 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(13), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:24.516 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(13), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:25.537 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(13), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:26.351 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(13), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:27.164 Waiting 0.200 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:27.364 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:28.338 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:29.115 Waiting 0.800 sec 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:29.915 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:30.857 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:31.632 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:32.412 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:33.192 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:34.014 Waiting 1.900 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), chaotic_energy(20), potion_of_the_old_war
2:35.914 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), chaotic_energy(20)
2:36.005 Waiting 0.100 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, crusade(15), zeal(3), chaotic_energy(20)
2:36.105 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, crusade(15), zeal(3), chaotic_energy(20)
2:37.036 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, crusade(15), zeal(3), chaotic_energy(20)
2:37.816 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), zeal(3), chaotic_energy(20)
2:37.816 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), zeal(3), chaotic_energy(20)
2:38.592 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), chaotic_energy(20)
2:39.368 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), chaotic_energy(20)
2:40.145 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(15), zeal(3), chaotic_energy(20)
2:40.919 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
2:42.102 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
2:43.285 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
2:44.467 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
2:45.649 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
2:46.831 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
2:48.014 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
2:49.196 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
2:50.379 Waiting 2.300 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), chaotic_energy(20)
2:52.679 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
2:52.679 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
2:53.861 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
2:55.079 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
2:56.262 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
2:57.444 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
2:58.627 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
2:59.810 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
3:00.993 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
3:02.177 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
3:03.359 Waiting 0.900 sec 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
3:04.259 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
3:05.685 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
3:06.866 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
3:08.049 Waiting 1.100 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), chaotic_energy(20)
3:09.149 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
3:09.149 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
3:10.332 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
3:11.514 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
3:12.698 Waiting 1.000 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
3:13.698 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
3:15.109 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
3:16.293 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
3:17.476 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
3:18.659 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
3:19.841 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
3:21.023 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement, zeal(3), chaotic_energy(20)
3:22.205 Waiting 1.400 sec 220000.0/220000: 100% mana | 0.0/5: 0% holy_power raid_movement, zeal(3), chaotic_energy(20)
3:23.605 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
3:23.605 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
3:24.789 Waiting 0.400 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, zeal(3), chaotic_energy(20)
3:25.189 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
3:25.189 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
3:26.370 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
3:27.552 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
3:28.734 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
3:29.916 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
3:31.097 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
3:32.277 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
3:33.461 Waiting 0.500 sec 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
3:33.961 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
3:35.390 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
3:36.573 Waiting 0.200 sec 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
3:36.773 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
3:38.158 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
3:39.341 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
3:40.524 Waiting 0.700 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, zeal(3), chaotic_energy(20)
3:41.224 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
3:41.224 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
3:42.460 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
3:43.645 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
3:44.828 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
3:46.010 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
3:47.192 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
3:48.375 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
3:49.558 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
3:50.740 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement, zeal(3), chaotic_energy(20)
3:51.922 Waiting 1.000 sec 220000.0/220000: 100% mana | 0.0/5: 0% holy_power raid_movement, zeal(3), chaotic_energy(20)
3:52.922 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power raid_movement, zeal(3), chaotic_energy(20)
3:54.258 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
3:54.258 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
3:55.439 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
3:56.620 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power raid_movement, zeal(3), chaotic_energy(20)
3:57.802 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
3:57.802 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
3:58.985 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
4:00.000 shield_of_vengeance Zipi 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
4:00.168 Waiting 1.000 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
4:01.168 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
4:02.501 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
4:03.683 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
4:04.865 Waiting 0.900 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
4:05.765 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
4:07.195 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
4:08.377 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
4:09.560 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
4:10.749 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
4:11.932 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
4:13.114 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power raid_movement, zeal(3), shield_of_vengeance, chaotic_energy(20)
4:14.298 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
4:14.298 crusade Zipi 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
4:14.298 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, zeal(3), shield_of_vengeance, chaotic_energy(20)
4:15.440 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(4), zeal(3), chaotic_energy(20)
4:16.479 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(4), zeal(3), chaotic_energy(20)
4:17.654 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(4), zeal(3), chaotic_energy(20)
4:18.850 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(4), zeal(3), chaotic_energy(20)
4:19.888 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(7), zeal(3), chaotic_energy(20)
4:20.839 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement, crusade(7), zeal(3), chaotic_energy(20)
4:21.789 Waiting 1.800 sec 220000.0/220000: 100% mana | 0.0/5: 0% holy_power raid_movement, crusade(10), zeal(3), chaotic_energy(20)
4:23.589 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(10), zeal(3), chaotic_energy(20)
4:23.589 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(10), zeal(3), chaotic_energy(20)
4:24.465 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(10), zeal(3), chaotic_energy(20)
4:25.341 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(10), zeal(3), chaotic_energy(20)
4:26.218 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(10), zeal(3), chaotic_energy(20)
4:27.096 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(10), zeal(3), chaotic_energy(20)
4:27.973 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(13), zeal(3), chaotic_energy(20)
4:28.789 Waiting 0.400 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, crusade(13), zeal(3), chaotic_energy(20)
4:29.189 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(13), zeal(3), chaotic_energy(20)
4:29.189 Waiting 1.400 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(13), zeal(3), chaotic_energy(20)
4:30.589 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(13), zeal(3), chaotic_energy(20)
4:31.566 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(13), zeal(3), chaotic_energy(20)
4:32.379 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(13), zeal(3), chaotic_energy(20)
4:33.192 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:33.976 Waiting 0.100 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:34.076 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:35.062 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:35.840 Waiting 1.200 sec 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:37.040 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:38.010 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:38.787 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:39.563 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:40.341 Waiting 0.800 sec 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:41.141 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:42.132 Waiting 0.300 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:42.432 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:43.416 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), zeal(3), chaotic_energy(20)
4:44.194 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power raid_movement, crusade(15), zeal(3), chaotic_energy(20)
4:44.970 Waiting 0.200 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power raid_movement, zeal(3), chaotic_energy(20)
4:45.170 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
4:45.170 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
4:46.351 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
4:47.534 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
4:48.718 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
4:49.900 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
4:51.082 Waiting 2.500 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), chaotic_energy(20)
4:53.582 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
4:53.582 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
4:54.764 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
4:55.947 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
4:57.129 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
4:58.310 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
4:59.493 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
5:00.675 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power raid_movement, zeal(3), chaotic_energy(20)
5:01.858 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
5:01.858 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
5:03.042 Waiting 0.900 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
5:03.942 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
5:05.368 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
5:06.552 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
5:07.736 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
5:08.918 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
5:10.101 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
5:11.283 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
5:12.465 Waiting 2.100 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
5:14.565 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
5:15.984 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
5:17.169 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
5:17.169 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
5:18.352 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
5:19.537 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
5:20.719 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
5:21.901 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
5:23.084 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
5:24.266 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
5:25.449 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
5:26.633 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
5:27.813 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
5:28.996 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
5:30.179 Waiting 1.000 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
5:31.179 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
5:32.531 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement, zeal(3), chaotic_energy(20)
5:33.712 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
5:33.712 Waiting 1.000 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
5:34.712 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
5:36.057 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
5:37.238 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
5:38.420 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
5:39.601 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
5:40.781 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
5:41.963 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
5:43.144 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
5:44.326 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
5:45.508 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
5:46.690 Waiting 2.100 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
5:48.790 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), chaotic_energy(20)
5:50.210 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
5:50.210 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
5:51.392 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
5:52.574 Waiting 1.000 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
5:53.574 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
5:54.932 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
5:56.115 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
5:57.299 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
5:58.481 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
5:59.662 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
6:00.000 shield_of_vengeance Zipi 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
6:00.844 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
6:02.025 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
6:03.208 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
6:04.391 Waiting 0.800 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, zeal(3), shield_of_vengeance, chaotic_energy(20)
6:05.191 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
6:05.191 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
6:06.374 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
6:07.557 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
6:08.739 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
6:09.920 Waiting 0.100 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
6:10.020 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
6:11.448 Waiting 1.000 sec 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
6:12.448 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
6:13.816 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
6:14.999 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20)
6:16.182 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
6:17.365 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
6:18.548 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20)
6:19.732 Waiting 1.500 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
6:21.232 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
6:21.232 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20)
6:22.575 crusade Zipi 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
6:22.575 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, zeal(3), chaotic_energy(20)
6:23.716 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, zeal(3), chaotic_energy(20)
6:24.858 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(4), zeal(3), chaotic_energy(20)
6:25.895 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(4), zeal(3), chaotic_energy(20)
6:26.932 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(4), zeal(3), chaotic_energy(20)
6:27.968 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(7), zeal(3), chaotic_energy(20)
6:28.918 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(7), zeal(3), chaotic_energy(20)
6:29.868 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(7), zeal(3), chaotic_energy(20)
6:30.818 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(10), zeal(3), chaotic_energy(20)
6:31.693 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(10), zeal(3), chaotic_energy(20)
6:32.569 Waiting 0.400 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(10), zeal(3), chaotic_energy(20)
6:32.969 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(10), zeal(3), chaotic_energy(20)
6:34.004 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(10), zeal(3), chaotic_energy(20)
6:34.881 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(13), zeal(3), chaotic_energy(20)
6:35.695 Waiting 0.500 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(13), zeal(3), chaotic_energy(20)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 26123 24417 13024 (10236)
Agility 3198 3198 0
Stamina 34526 34526 20992
Intellect 7326 7326 0
Spirit 0 0 0
Health 2071560 2071560 0
Mana 220000 220000 0
Holy Power 5 5 0
Spell Power 26123 24417 0
Crit 24.58% 24.58% 6853
Haste 27.33% 26.18% 8507
Damage / Heal Versatility 1.50% 1.50% 599
Attack Power 26123 24417 0
Mastery 21.78% 21.78% 2283
Armor 4147 4147 4147
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 855.00
Local Head Greystone Helm
ilevel: 835, stats: { 536 Armor, +1128 StrInt, +1692 Sta, +723 Haste, +511 Crit }
Local Neck Pendant of the Watchful Eye
ilevel: 825, stats: { +867 Sta, +1099 Haste, +573 Crit }
Local Shoulders Nightsfall Shoulderplates
ilevel: 870, stats: { 535 Armor, +1172 StrInt, +1758 Sta, +618 Haste, +437 Mastery }
Local Chest Breastplate of Preservation
ilevel: 860, stats: { 698 Armor, +1424 StrInt, +2136 Sta, +939 Crit, +416 Mastery }
Local Waist Chain of Thrayn
ilevel: 895, stats: { 424 Armor, +2219 Sta, +1479 StrInt, +413 Crit, +745 Haste }
Local Legs Wracksoul Legplates
ilevel: 845, stats: { 591 Armor, +1238 StrInt, +1857 Sta, +888 Crit, +393 Haste }
Local Feet Warboots of Smoldering Fury
ilevel: 860, stats: { 480 Armor, +1601 Sta, +1068 StrInt, +661 Haste, +355 Mastery }
Local Wrists Wristclamps of Mad Dreams
ilevel: 870, stats: { 312 Armor, +1319 Sta, +879 StrInt, +481 Crit, +311 Haste }
Local Hands Tarnished Dreamkeeper's Gauntlets
ilevel: 865, stats: { 441 Armor, +1678 Sta, +1119 StrInt, +673 Haste, +362 Mastery }
Local Finger1 An'she's Band
ilevel: 840, stats: { +997 Sta, +1011 Haste, +758 Crit }
Local Finger2 Utgarde Royal Signet
ilevel: 860, stats: { +1201 Sta, +1307 Crit, +599 Vers }
Local Trinket1 Chaos Talisman
ilevel: 840, stats: { +898 Haste }
Local Trinket2 Nightborne Defender's Badge
ilevel: 835, stats: { +1073 Str, +882 Haste }
Local Back Evergreen Vinewrap Drape
ilevel: 850, stats: { 130 Armor, +729 StrAgiInt, +1094 Sta, +493 Haste, +241 Crit }
Local Main Hand Ashbringer
ilevel: 880, weapon: { 8875 - 13315, 3.6 }, stats: { +1715 Str, +2573 Sta, +742 Crit, +713 Mastery }, relics: { +45 ilevels, +48 ilevels, +37 ilevels }

Talents

Level
15 Final Verdict (Retribution Paladin) Execution Sentence (Retribution Paladin) Consecration (Retribution Paladin)
30 The Fires of Justice (Retribution Paladin) Zeal (Retribution Paladin) Greater Judgment (Retribution Paladin)
45 Fist of Justice Repentance Blinding Light
60 Virtue's Blade (Retribution Paladin) Blade of Wrath (Retribution Paladin) Divine Hammer (Retribution Paladin)
75 Justicar's Vengeance (Retribution Paladin) Eye for an Eye (Retribution Paladin) Word of Glory (Retribution Paladin)
90 Divine Intervention (Retribution Paladin) Cavalier (Retribution Paladin) Seal of Light (Retribution Paladin)
100 Divine Purpose (Retribution Paladin) Crusade (Retribution Paladin) Holy Wrath (Retribution Paladin)

Profile

paladin="Zipi"
origin="https://us.api.battle.net/wow/character/thrall/Zipi/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/146/160036754-avatar.jpg"
level=110
race=tauren
role=attack
position=back
professions=mining=616/herbalism=486
talents=2231223
artifact=2:0:0:0:0:40:1:41:3:42:3:43:3:50:3:51:3:53:3:350:1:351:1:353:1:1275:1
spec=retribution

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_countless_armies
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/greater_blessing_of_might
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=auto_attack
actions+=/rebuke
actions+=/potion,name=old_war,if=(buff.bloodlust.react|buff.avenging_wrath.up|buff.crusade.up|target.time_to_die<=40)
actions+=/holy_wrath
actions+=/avenging_wrath
actions+=/shield_of_vengeance
actions+=/crusade,if=holy_power>=5
actions+=/wake_of_ashes,if=holy_power>=0&time<2
actions+=/execution_sentence,if=spell_targets.divine_storm<=3&(cooldown.judgment.remains<gcd*4.5|debuff.judgment.remains>gcd*4.67)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent,if=holy_power<5
actions+=/call_action_list,name=VB,if=talent.virtues_blade.enabled
actions+=/call_action_list,name=DH,if=talent.divine_hammer.enabled

actions.DH=divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
actions.DH+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&buff.divine_purpose.react
actions.DH+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.DH+=/justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2&!equipped.whisper_of_the_nathrezim
actions.DH+=/justicars_vengeance,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
actions.DH+=/templars_verdict,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
actions.DH+=/templars_verdict,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react
actions.DH+=/templars_verdict,if=debuff.judgment.up&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.DH+=/divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.DH+=/justicars_vengeance,if=debuff.judgment.up&holy_power>=3&buff.divine_purpose.up&cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled&!equipped.whisper_of_the_nathrezim
actions.DH+=/templars_verdict,if=debuff.judgment.up&holy_power>=3&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.DH+=/wake_of_ashes,if=holy_power<=1
actions.DH+=/zeal,if=charges=2&holy_power<=4
actions.DH+=/crusader_strike,if=charges=2&holy_power<=4
actions.DH+=/divine_hammer,if=holy_power<=3
actions.DH+=/judgment
actions.DH+=/consecration
actions.DH+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.react
actions.DH+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)
actions.DH+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*6)
actions.DH+=/justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
actions.DH+=/templars_verdict,if=debuff.judgment.up&buff.divine_purpose.react
actions.DH+=/templars_verdict,if=debuff.judgment.up&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)
actions.DH+=/templars_verdict,if=debuff.judgment.up&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*6)
actions.DH+=/zeal,if=holy_power<=4
actions.DH+=/crusader_strike,if=holy_power<=4

actions.VB=divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
actions.VB+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&buff.divine_purpose.react
actions.VB+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.VB+=/justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2&!equipped.whisper_of_the_nathrezim
actions.VB+=/justicars_vengeance,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
actions.VB+=/templars_verdict,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
actions.VB+=/templars_verdict,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react
actions.VB+=/templars_verdict,if=debuff.judgment.up&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.VB+=/divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.VB+=/justicars_vengeance,if=debuff.judgment.up&holy_power>=3&buff.divine_purpose.up&cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled&!equipped.whisper_of_the_nathrezim
actions.VB+=/templars_verdict,if=debuff.judgment.up&holy_power>=3&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.VB+=/wake_of_ashes,if=holy_power=0|holy_power=1&cooldown.blade_of_justice.remains>gcd|holy_power=2&(cooldown.zeal.charges_fractional<=0.34|cooldown.crusader_strike.charges_fractional<=0.34)
actions.VB+=/zeal,if=charges=2&holy_power<=4
actions.VB+=/crusader_strike,if=charges=2&holy_power<=4
actions.VB+=/blade_of_justice,if=holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
actions.VB+=/judgment,if=holy_power>=3|((cooldown.zeal.charges_fractional<=1.67|cooldown.crusader_strike.charges_fractional<=1.67)&cooldown.blade_of_justice.remains>gcd)|(talent.greater_judgment.enabled&target.health.pct>50)
actions.VB+=/consecration
actions.VB+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.react
actions.VB+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.VB+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=4&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.VB+=/justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
actions.VB+=/templars_verdict,if=debuff.judgment.up&buff.divine_purpose.react
actions.VB+=/templars_verdict,if=debuff.judgment.up&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.VB+=/templars_verdict,if=debuff.judgment.up&holy_power>=4&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.VB+=/zeal,if=holy_power<=4
actions.VB+=/crusader_strike,if=holy_power<=4
actions.VB+=/divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)
actions.VB+=/templars_verdict,if=debuff.judgment.up&holy_power>=3&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)

head=greystone_helm,id=139096,bonus_id=3432/1497/1674
neck=pendant_of_the_watchful_eye,id=137536,bonus_id=1726/1477
shoulders=nightsfall_shoulderplates,id=139060,bonus_id=3432/1532/3337
back=evergreen_vinewrap_drape,id=139248,bonus_id=1807/1472
chest=breastplate_of_preservation,id=134500,bonus_id=3412/1512/3336
wrists=wristclamps_of_mad_dreams,id=139235,bonus_id=1807/1492/3337
hands=tarnished_dreamkeepers_gauntlets,id=141695,bonus_id=1805/1487
waist=chain_of_thrayn,id=137086,bonus_id=1811
legs=wracksoul_legplates,id=121280,bonus_id=3432/1507/3336
feet=warboots_of_smoldering_fury,id=141437,bonus_id=1472
finger1=anshes_band,id=139103,bonus_id=3473/1502/1674
finger2=utgarde_royal_signet,id=133637,bonus_id=3411/1512/3337
trinket1=chaos_talisman,id=137459,bonus_id=1727/1492/1813
trinket2=nightborne_defenders_badge,id=134278,bonus_id=3432/604/1497/1674
main_hand=ashbringer,id=120978,bonus_id=737,gem_id=141276/141522/141260/0,relic_id=3397:1517:3337/1477:3336/3396:1492:3339/0

# Gear Summary
# gear_ilvl=855.33
# gear_strength=13024
# gear_stamina=20992
# gear_crit_rating=6853
# gear_haste_rating=8507
# gear_mastery_rating=2283
# gear_versatility_rating=599
# gear_armor=4147

Faelik

Faelik : 395768 dps, 269969 dps to main target

  • Race: Undead
  • Class: Priest
  • Spec: Shadow
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
395768.3 395768.3 422.7 / 0.107% 84192.2 / 21.3% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.96% 52.6 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Faelik/advanced
Talents
  • 15: Twist of Fate (Shadow Priest)
  • 30: Body and Soul
  • 45: Mind Bomb (Shadow Priest)
  • 60: Void Lord (Shadow Priest)
  • 75: Auspicious Spirits (Shadow Priest)
  • 90: Power Infusion (Shadow Priest)
  • 100: Legacy of the Void (Shadow Priest)
  • Talent Calculator
Artifact
Professions
  • alchemy: 503
  • herbalism: 800
Scale Factors for Faelik Damage Per Second
Haste Crit Int Mastery Vers
Scale Factors 14.17 12.85 12.65 12.07 10.02
Normalized 1.12 1.02 1.00 0.95 0.79
Scale Deltas 1138 1138 1138 1138 1138
Error 0.53 0.53 0.54 0.53 0.53
Gear Ranking
Optimizers
Ranking
  • Haste > Crit ~= Int > Mastery > Vers
Pawn string ( Pawn: v1: "Faelik": Intellect=12.65, CritRating=12.85, HasteRating=14.17, MasteryRating=12.07, Versatility=10.02 )

Scale Factors for other metrics

Scale Factors for Faelik Damage Per Second
Haste Crit Int Mastery Vers
Scale Factors 14.17 12.85 12.65 12.07 10.02
Normalized 1.12 1.02 1.00 0.95 0.79
Scale Deltas 1138 1138 1138 1138 1138
Error 0.53 0.53 0.54 0.53 0.53
Gear Ranking
Optimizers
Ranking
  • Haste > Crit ~= Int > Mastery > Vers
Pawn string ( Pawn: v1: "Faelik": Intellect=12.65, CritRating=12.85, HasteRating=14.17, MasteryRating=12.07, Versatility=10.02 )
Scale Factors for Faelik Priority Target Damage Per Second
Crit Haste Int Mastery Vers
Scale Factors 9.34 9.24 8.57 7.96 6.84
Normalized 1.09 1.08 1.00 0.93 0.80
Scale Deltas 1138 1138 1138 1138 1138
Error 0.20 0.19 0.20 0.19 0.20
Gear Ranking
Optimizers
Ranking
  • Crit ~= Haste > Int > Mastery > Vers
Pawn string ( Pawn: v1: "Faelik": Intellect=8.57, CritRating=9.34, HasteRating=9.24, MasteryRating=7.96, Versatility=6.84 )
Scale Factors for Faelik Damage Per Second (Effective)
Haste Crit Int Mastery Vers
Scale Factors 14.17 12.85 12.65 12.07 10.02
Normalized 1.12 1.02 1.00 0.95 0.79
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Haste > Crit > Int > Mastery > Vers
Pawn string ( Pawn: v1: "Faelik": Intellect=12.65, CritRating=12.85, HasteRating=14.17, MasteryRating=12.07, Versatility=10.02 )
Scale Factors for Faelik Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Faelik Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Faelik Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Faelik Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Faelik Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Faelik Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Faelik Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for FaelikTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Faelik 395768
Deadly Grace 9361 2.3% 29.6 13.99sec 125187 0 Direct 29.5 96619 193452 125334 29.7%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.56 29.52 0.00 0.00 0.0000 0.0000 3700034.65 3700034.65 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.77 70.34% 96619.34 87722 105266 96602.54 89071 102076 2006373 2006373 0.00
crit 8.75 29.66% 193452.17 175443 210532 193453.03 175443 210532 1693661 1693661 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Mind Blast 29833 7.6% 56.4 7.03sec 211939 217266 Direct 57.4 160617 321403 208246 29.6%  

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.40 57.40 0.00 0.00 0.9755 0.0000 11953552.20 11953552.20 0.00 217266.21 217266.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.40 70.38% 160617.19 116880 182333 160629.13 149096 170140 6488395 6488395 0.00
crit 17.00 29.62% 321403.26 233761 364667 321421.50 271162 364667 5465157 5465157 0.00
 
 

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage.$?a185916[ |cFFFFFFFFGenerates {$/100;s2=12} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mind Flay 16246 4.2% 56.5 7.13sec 117961 78848 Periodic 152.6 33639 67402 43640 29.6% 18.4%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.45 0.00 152.59 152.59 1.4961 0.4837 6659337.60 6659337.60 0.00 78847.92 78847.92
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 107.4 70.38% 33639.06 24336 38054 33635.40 30240 36359 3612586 3612586 0.00
crit 45.2 29.62% 67401.86 48673 76109 67409.55 57244 75016 3046752 3046752 0.00
 
 

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.mind_spike.enabled
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}$?s120585[. Each time Mind Flay deals damage, the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]$?a185916[ |cFFFFFFFFGenerates ${4*$m3/100} Insanity over the duration.|r][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.550000
  • base_td:1.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Mind Sear 41768 10.4% 34.6 8.23sec 477302 328981 Periodic 465.2 27331 54669 35462 29.7% 10.2%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.57 0.00 82.67 465.24 1.4509 0.4932 16498409.47 16498409.47 0.00 328981.25 328981.25
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 326.9 70.26% 27331.01 19957 31134 27343.97 24841 29204 8933445 8933445 0.00
crit 138.4 29.74% 54668.92 39915 62267 54694.86 48906 59213 7564965 7564965 0.00
 
 

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing Shadow damage to all targets within $49821a2 yards.
  • description:Corrosive shadow energy radiates from the target, dealing ${$49821m2*6} Shadow damage over {$48045d=5 seconds} to all enemies within $49821a2 yards of the target. |cFFFFFFFFGenerates ${$208232m1*6/100} Insanity over the duration per target hit.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a2 yards.
  • description:{$@spelldesc48045=Corrosive shadow energy radiates from the target, dealing ${$49821m2*6} Shadow damage over {$48045d=5 seconds} to all enemies within $49821a2 yards of the target. |cFFFFFFFFGenerates ${$208232m1*6/100} Insanity over the duration per target hit.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.540000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Shadow Word: Death 4636 1.2% 7.6 10.05sec 242468 252174 Direct 7.6 186750 372923 242479 29.9%  

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.63 7.63 0.00 0.00 0.9616 0.0000 1850704.50 1850704.50 0.00 252173.93 252173.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.35 70.07% 186749.66 148463 193001 186738.10 0 193001 998797 998797 0.00
crit 2.28 29.93% 372922.71 296925 386003 345865.19 0 386003 851907 851907 0.00
 
 

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=1} Shadow damage to the target. Only usable on enemies that have less than {$s2=20}% health. |cFFFFFFFFGenerates {$s3=10} Insanity, or $/100;190714s1 if the target dies.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.250000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Shadow Word: Pain 58839 (71249) 14.9% (18.0%) 47.0 8.33sec 605071 628690 Direct 47.0 39720 79596 51559 29.7%  
Periodic 337.0 48273 96609 62630 29.7% 104.5%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.02 47.02 337.03 337.03 0.9624 1.2427 23532469.42 23532469.42 0.00 61299.12 628690.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.06 70.31% 39719.93 25705 75388 39762.18 33505 47606 1313064 1313064 0.00
crit 13.96 29.69% 79595.87 51410 149171 79668.46 57456 105625 1111133 1111133 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 236.9 70.30% 48272.74 507 85383 48293.25 45139 52162 11437049 11437049 0.00
crit 100.1 29.70% 96609.44 1150 170765 96598.02 86143 116848 9671224 9671224 0.00
 
 

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<(3+(4%3))*gcd
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A word of darkness that causes {$s1=1} Shadow damage instantly, and an additional $o2 Shadow damage over {$d=14 seconds}.$?a185916[ |cFFFFFFFFGenerates ${$m3/100} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.410000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.450000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Sphere of Insanity 12410 3.1% 276.4 1.39sec 17786 0 Direct 366.7 13407 0 13407 0.0%  

Stats details: sphere_of_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 276.42 366.71 0.00 0.00 0.0000 0.0000 4916392.01 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 366.71 100.00% 13406.53 7597 37296 13419.84 11160 16468 4916392 0 0.00
 
 

Action details: sphere_of_insanity

Static Values
  • id:194182
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:194182
  • name:Sphere of Insanity
  • school:physical
  • tooltip:
  • description:{$@spelldesc194179=The Sphere of Insanity manifests for the duration of Voidform. Your Void Bolts, Mind Blasts, and {$?s73510=false}[Mind Spikes][Mind Flays] cause the sphere to duplicate {$194182s3=5}% their damage to all enemies affected by your Shadow Word: Pain.}
 
Shadowy Apparitions 16634 4.2% 181.8 2.18sec 36527 0 Direct 180.3 28211 56471 36825 30.5%  

Stats details: shadowy_apparitions

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 181.82 180.34 0.00 0.00 0.0000 0.0000 6641261.27 6641261.27 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 125.37 69.52% 28211.06 20327 31710 28214.49 26727 29552 3536824 3536824 0.00
crit 54.97 30.48% 56471.24 40654 63420 56472.71 51439 60611 3104437 3104437 0.00
 
 

Action details: shadowy_apparitions

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=0} Shadow damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.275000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Touch of the Grave 3225 0.8% 25.3 16.12sec 51136 0 Direct 25.3 51136 0 51136 0.0%  

Stats details: touch_of_the_grave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.28 25.28 0.00 0.00 0.0000 0.0000 1292663.75 1292663.75 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.28 100.00% 51135.81 36958 57655 51143.60 48110 54791 1292664 1292664 0.00
 
 

Action details: touch_of_the_grave

Static Values
  • id:127802
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:127802
  • name:Touch of the Grave
  • school:shadow
  • tooltip:
  • description:{$@spelldesc5227=Your attacks and damaging spells have a chance to drain the target, dealing ${$max($AP,$SPH)*$pctD*(1+$@versadmg)} Shadow damage and healing you for the same amount. Additionally, you can breathe underwater indefinitely.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:1.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Vampiric Touch 117799 29.7% 39.3 7.79sec 1193005 1242885 Periodic 458.9 78699 157531 102105 29.7% 207.1%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.27 0.00 458.87 458.87 0.9599 1.8098 46853025.40 46853025.40 0.00 53966.33 1242884.72
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 322.6 70.31% 78698.87 66 139728 78693.22 70664 86034 25390171 25390171 0.00
crit 136.2 29.69% 157530.83 803 279455 157498.05 137579 177387 21462854 21462854 0.00
 
 

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.vampiric_touch.remains<(4+(4%3))*gcd
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A touch of darkness that causes $34914o2 Shadow damage over {$34914d=18 seconds}, and heals the Priest for ${$e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates ${$m3/100} Insanity.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.790000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Void Bolt 53909 13.7% 91.4 4.19sec 236188 252496 Direct 91.1 182629 365187 236868 29.7%  

Stats details: void_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.38 91.11 0.00 0.00 0.9354 0.0000 21582114.48 21582114.48 0.00 252496.22 252496.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.04 70.29% 182628.96 122195 190624 182639.61 177386 187627 11696196 11696196 0.00
crit 27.07 29.71% 365186.93 244390 381248 365217.37 345334 381248 9885919 9885919 0.00
 
 

Action details: void_bolt

Static Values
  • id:205448
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10
Spelldata
  • id:205448
  • name:Void Bolt
  • school:shadow
  • tooltip:
  • description:Sends a bolt of pure void energy at the enemy, causing {$s1=1} Shadow damage$?a231688[ and refreshing Shadow Word: Pain and Vampiric Touch to their original duration][]. Requires Voidform. |cFFFFFFFFGenerates {$/100;s3=16} Insanity.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Eruption 10006 2.5% 10.9 37.20sec 364837 0 Direct 51.5 59592 119162 77324 29.8%  

Stats details: void_eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.91 51.47 0.00 0.00 0.0000 0.0000 3979706.39 3979706.39 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.15 70.23% 59592.46 55438 66526 59631.37 55709 64904 2154083 2154083 0.00
crit 15.32 29.77% 119161.72 110877 133052 119239.04 110877 133052 1825623 1825623 0.00
 
 

Action details: void_eruption

Static Values
  • id:228360
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:18.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
Spelldata
  • id:228360
  • name:Void Eruption
  • school:shadow
  • tooltip:
  • description:{$@spelldesc228260=Releases an explosive blast of pure void energy, activating Voidform and causing {$228360s1=1} Shadow damage to all enemies afflicted by your Shadow Word: Pain or Vampiric Touch. During Voidform, this ability is replaced by Void Bolt. |cFFFFFFFFRequires ${$C/100} Insanity to activate.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Torrent 13883 3.5% 6.7 62.24sec 825614 263826 Periodic 37.1 115480 230977 150036 29.9% 4.7%

Stats details: void_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.74 0.00 37.11 37.11 3.1294 0.5128 5568581.25 5568581.25 0.00 263826.28 263826.28
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.0 70.08% 115479.91 141 126842 115539.51 98203 126842 3003583 3003583 0.00
crit 11.1 29.92% 230976.85 455 253685 231132.42 0 253685 2564998 2564998 0.00
 
 

Action details: void_torrent

Static Values
  • id:205065
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205065
  • name:Void Torrent
  • school:shadow
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:2.200000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - shadowfiend 104248 / 7221
melee 104248 1.8% 32.7 8.76sec 88682 116843 Direct 32.7 68433 136859 88683 29.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.70 32.70 0.00 0.00 0.7590 0.0000 2900165.71 2900165.71 0.00 116843.23 116843.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.03 70.41% 68432.60 61162 70336 68424.93 66166 70336 1575661 1575661 0.00
crit 9.68 29.59% 136858.85 122324 140673 136819.47 0 140673 1324505 1324505 0.00
 
 

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Simple Action Stats Execute Interval
Faelik
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Faelik
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Faelik
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Faelik
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Power Infusion 3.6 122.68sec

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.55 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.insanity_drain_stacks.stack>=85
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Haste increased by {$s1=25}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses you with power for {$d=20 seconds}, increasing haste by {$s1=25}%{$?s185916=false}[ and increasing Insanity generation by {$s3=25}%][ and reducing the mana cost of all spells by {$s2=20}%].
 
Shadowfiend 2.4 197.47sec

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.36 0.00 0.00 0.00 0.9118 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled&!talent.surrender_to_madness.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Summons a shadowy fiend to attack the target for {$d=12 seconds}.
 
Shadowform 1.0 0.00sec

Stats details: shadowform

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowform

Static Values
  • id:232698
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.shadowform.up
Spelldata
  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Shadow damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your Shadow damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
 
pet - shadowfiend
Shadowcrawl 4.7 74.29sec

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.69 0.00 0.00 0.00 0.9020 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.12% 11.09% 0.0(0.0) 1.0

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Burning Intensity 4.7 0.0 74.2sec 73.8sec 22.65% 22.65% 4.4(4.4) 4.4

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_burning_intensity
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:337.58

Stack Uptimes

  • burning_intensity_1:1.16%
  • burning_intensity_2:1.16%
  • burning_intensity_3:1.16%
  • burning_intensity_4:1.15%
  • burning_intensity_5:1.15%
  • burning_intensity_6:1.15%
  • burning_intensity_7:1.14%
  • burning_intensity_8:1.14%
  • burning_intensity_9:1.14%
  • burning_intensity_10:1.13%
  • burning_intensity_11:1.13%
  • burning_intensity_12:1.13%
  • burning_intensity_13:1.13%
  • burning_intensity_14:1.12%
  • burning_intensity_15:1.12%
  • burning_intensity_16:1.12%
  • burning_intensity_17:1.11%
  • burning_intensity_18:1.11%
  • burning_intensity_19:1.11%
  • burning_intensity_20:1.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:215816
  • name:Burning Intensity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc215813=Your damaging spells have a chance to grant you {$215816s1=319} Critical Strike every $215815t2 sec for {$215815d=20 seconds}.}
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
insanity_drain_stacks 10.9 264.6 37.2sec 37.2sec 71.99% 71.99% 0.0(0.0) 0.0

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_insanity_drain_stacks
  • max_stacks:999
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • insanity_drain_stacks_1:3.95%
  • insanity_drain_stacks_2:2.75%
  • insanity_drain_stacks_3:2.75%
  • insanity_drain_stacks_4:2.76%
  • insanity_drain_stacks_5:2.72%
  • insanity_drain_stacks_6:2.69%
  • insanity_drain_stacks_7:2.74%
  • insanity_drain_stacks_8:2.69%
  • insanity_drain_stacks_9:2.68%
  • insanity_drain_stacks_10:2.79%
  • insanity_drain_stacks_11:2.81%
  • insanity_drain_stacks_12:2.78%
  • insanity_drain_stacks_13:3.10%
  • insanity_drain_stacks_14:3.08%
  • insanity_drain_stacks_15:2.72%
  • insanity_drain_stacks_16:2.83%
  • insanity_drain_stacks_17:2.99%
  • insanity_drain_stacks_18:2.76%
  • insanity_drain_stacks_19:2.73%
  • insanity_drain_stacks_20:2.64%
  • insanity_drain_stacks_21:2.19%
  • insanity_drain_stacks_22:1.89%
  • insanity_drain_stacks_23:1.59%
  • insanity_drain_stacks_24:1.21%
  • insanity_drain_stacks_25:0.99%
  • insanity_drain_stacks_26:0.84%
  • insanity_drain_stacks_27:0.75%
  • insanity_drain_stacks_28:0.71%
  • insanity_drain_stacks_29:0.70%
  • insanity_drain_stacks_30:0.68%
  • insanity_drain_stacks_31:0.66%
  • insanity_drain_stacks_32:0.62%
  • insanity_drain_stacks_33:0.51%
  • insanity_drain_stacks_34:0.40%
  • insanity_drain_stacks_35:0.34%
  • insanity_drain_stacks_36:0.29%
  • insanity_drain_stacks_37:0.24%
  • insanity_drain_stacks_38:0.19%
  • insanity_drain_stacks_39:0.13%
  • insanity_drain_stacks_40:0.07%
  • insanity_drain_stacks_41:0.02%
  • insanity_drain_stacks_42:0.01%
  • insanity_drain_stacks_43:0.00%
  • insanity_drain_stacks_44:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%
Lingering Insanity 10.9 0.0 35.3sec 35.3sec 44.16% 90.65% 0.0(0.0) 9.7

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_lingering_insanity
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lingering_insanity_15:0.00%
  • lingering_insanity_16:0.00%
  • lingering_insanity_17:0.03%
  • lingering_insanity_18:0.19%
  • lingering_insanity_19:0.77%
  • lingering_insanity_20:2.57%
  • lingering_insanity_21:5.88%
  • lingering_insanity_22:3.83%
  • lingering_insanity_23:2.99%
  • lingering_insanity_24:2.95%
  • lingering_insanity_25:2.50%
  • lingering_insanity_26:2.50%
  • lingering_insanity_27:2.49%
  • lingering_insanity_28:1.92%
  • lingering_insanity_29:1.47%
  • lingering_insanity_30:0.72%
  • lingering_insanity_31:0.51%
  • lingering_insanity_32:0.38%
  • lingering_insanity_33:0.22%
  • lingering_insanity_34:0.34%
  • lingering_insanity_35:0.78%
  • lingering_insanity_36:3.07%
  • lingering_insanity_37:1.48%
  • lingering_insanity_38:1.11%
  • lingering_insanity_39:0.52%
  • lingering_insanity_40:0.56%
  • lingering_insanity_41:0.75%
  • lingering_insanity_42:1.07%
  • lingering_insanity_43:1.10%
  • lingering_insanity_44:0.86%
  • lingering_insanity_45:0.45%
  • lingering_insanity_46:0.13%
  • lingering_insanity_47:0.03%
  • lingering_insanity_48:0.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197937
  • name:Lingering Insanity
  • tooltip:Haste increased by $w1%.
  • description:{$@spelldesc194249={$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing all damage you deal by {$194249s1=30}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and granting an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you return to normal Shadowform, and you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}}
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
mind_sear_on_hit_reset 14.2 20.4 20.7sec 8.2sec 29.79% 29.79% 0.0(0.0) 14.0

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_mind_sear_on_hit_reset
  • max_stacks:2
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • mind_sear_on_hit_reset_1:29.79%

Trigger Attempt Success

  • trigger_pct:100.00%
Potion of Deadly Grace 2.0 0.0 364.7sec 0.0sec 12.15% 12.15% 0.0(0.0) 2.0

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:12.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Power Infusion 3.6 0.0 122.7sec 122.7sec 17.42% 17.42% 0.0(0.0) 3.4

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • power_infusion_1:17.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Haste increased by {$s1=25}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses you with power for {$d=20 seconds}, increasing haste by {$s1=25}%{$?s185916=false}[ and increasing Insanity generation by {$s3=25}%][ and reducing the mana cost of all spells by {$s2=20}%].
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 14.53% 14.53% 2.0(2.0) 0.0

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.53%

Trigger Attempt Success

  • trigger_pct:100.00%
Sphere of Insanity 10.9 0.0 37.2sec 37.2sec 71.99% 74.76% 0.0(0.0) 0.0

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_sphere_of_insanity
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • sphere_of_insanity_1:71.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194182
  • name:Sphere of Insanity
  • tooltip:
  • description:{$@spelldesc194179=The Sphere of Insanity manifests for the duration of Voidform. Your Void Bolts, Mind Blasts, and {$?s73510=false}[Mind Spikes][Mind Flays] cause the sphere to duplicate {$194182s3=5}% their damage to all enemies affected by your Shadow Word: Pain.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:0.00%
Twist of Fate 8.5 863.2 29.7sec 0.4sec 66.27% 66.27% 863.2(863.2) 7.5

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • twist_of_fate_1:66.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After {$?s15407=true}[damaging][healing] a target below {$s1=35}% health, you deal {$123254s2=20}% increased damage and {$123254s1=20}% increased healing for {$123254d=10 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Void Torrent 6.7 0.0 62.2sec 62.2sec 5.01% 5.01% 0.0(0.0) 3.5

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_void_torrent
  • max_stacks:1
  • duration:4.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • void_torrent_1:5.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205065
  • name:Void Torrent
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
  • max_stacks:0
  • duration:4.00
  • cooldown:60.00
  • default_chance:0.00%
Voidform 10.9 0.0 37.2sec 37.2sec 71.99% 74.02% 0.0(0.0) 0.0

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_voidform
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • voidform_1:2.72%
  • voidform_2:2.71%
  • voidform_3:2.70%
  • voidform_4:2.70%
  • voidform_5:2.69%
  • voidform_6:2.68%
  • voidform_7:2.68%
  • voidform_8:2.67%
  • voidform_9:2.66%
  • voidform_10:2.66%
  • voidform_11:2.65%
  • voidform_12:2.64%
  • voidform_13:2.64%
  • voidform_14:2.63%
  • voidform_15:2.62%
  • voidform_16:2.62%
  • voidform_17:2.61%
  • voidform_18:2.60%
  • voidform_19:2.57%
  • voidform_20:2.48%
  • voidform_21:2.22%
  • voidform_22:1.90%
  • voidform_23:1.72%
  • voidform_24:1.53%
  • voidform_25:1.36%
  • voidform_26:1.22%
  • voidform_27:1.06%
  • voidform_28:0.92%
  • voidform_29:0.81%
  • voidform_30:0.75%
  • voidform_31:0.71%
  • voidform_32:0.68%
  • voidform_33:0.66%
  • voidform_34:0.64%
  • voidform_35:0.61%
  • voidform_36:0.50%
  • voidform_37:0.38%
  • voidform_38:0.32%
  • voidform_39:0.27%
  • voidform_40:0.24%
  • voidform_41:0.21%
  • voidform_42:0.16%
  • voidform_43:0.10%
  • voidform_44:0.05%
  • voidform_45:0.02%
  • voidform_46:0.00%
  • voidform_47:0.00%
  • voidform_48:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194249
  • name:Voidform
  • tooltip:Cooldown on Mind Blast reduced by ${$w6/1000} sec. Shadow damage dealt increased by $w1%. Haste increased by $w3%. Losing ${$w2/500} Insanity every sec.
  • description:{$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing all damage you deal by {$194249s1=30}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and granting an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you return to normal Shadowform, and you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}
  • max_stacks:100
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend: raid_movement 0.4 0.0 0.0sec 0.0sec 5.09% 5.09% 0.0(0.0) 0.0

Buff details

  • buff initial source:Faelik_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:5.09%

Trigger Attempt Success

  • trigger_pct:39.26%
shadowfiend: Shadowcrawl 4.7 0.0 74.4sec 74.4sec 83.43% 79.14% 0.0(0.0) 4.6

Buff details

  • buff initial source:Faelik_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadowcrawl_1:83.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:0
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Shadowform

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:232698
  • name:Shadowform
  • tooltip:Shadow damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your Shadow damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Faelik
Resource Gains Type Count Total Average Overflow
Insanity Gained from Auspicious Spirits Insanity 180.35 689.93 (1252.26%) 3.83 31.46 4.36%
Insanity Drained by Voidform Insanity 5767.08 -4360.80 (-7915.08%) -0.76 0.00 -0.00%
Insanity Gained from Mind Blast Insanity 57.40 679.14 (1232.67%) 11.83 9.67 1.40%
Insanity Gained from Mind Flay Insanity 152.59 305.12 (553.82%) 2.00 0.06 0.02%
Insanity Gained from Mind Sear Insanity 465.24 640.55 (1162.64%) 1.38 57.31 8.21%
Insanity Gained from Power Infusion Insanity 256.57 213.54 (387.59%) 0.83 57.31 21.16%
Insanity Gained from Shadow Word: Death Insanity 7.63 74.64 (135.48%) 9.78 1.85 2.41%
Insanity Gained from Shadow Word: Pain Casts Insanity 47.02 140.96 (255.86%) 3.00 0.09 0.07%
Insanity Gained from Vampiric Touch Casts Insanity 39.27 157.06 (285.07%) 4.00 0.04 0.02%
Insanity Gained from Void Bolt Insanity 91.38 1241.61 (2253.59%) 13.59 220.43 15.08%
Insanity Saved by Void Torrent Insanity 400.61 273.34 (496.12%) 0.68 0.00 0.00%
Health from Vampiric Touch Ticks Health 458.88 0.00 (0.00%) 0.00 23426967.49 100.00%
mp5_regen Mana 905.23 0.00 (0.00%) 0.00 3524606.99 100.00%
Resource RPS-Gain RPS-Loss
Insanity 11.01 10.87
Combat End Resource Mean Min Max
Mana 1100000.00 1100000.00 1100000.00
Insanity 55.12 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
Shadowy Apparition Insanity lost to overflow 181.8 2.2sec
Void Eruption casted when a target with both DoTs was up 12.4 37.2sec
Void Eruption casted when a target with no DoTs was up 9.5 44.4sec
Void Eruption casted when a target with only Shadow Word: Pain was up 0.4 113.6sec
Void Eruption casted when a target with only Vampiric Touch was up 26.3 36.6sec

Statistics & Data Analysis

Fight Length
Sample Data Faelik Fight Length
Count 9999
Mean 401.00
Minimum 308.02
Maximum 501.87
Spread ( max - min ) 193.85
Range [ ( max - min ) / 2 * 100% ] 24.17%
DPS
Sample Data Faelik Damage Per Second
Count 9999
Mean 395768.34
Minimum 338148.65
Maximum 481535.24
Spread ( max - min ) 143386.59
Range [ ( max - min ) / 2 * 100% ] 18.11%
Standard Deviation 21566.7027
5th Percentile 363644.69
95th Percentile 434855.71
( 95th Percentile - 5th Percentile ) 71211.01
Mean Distribution
Standard Deviation 215.6778
95.00% Confidence Intervall ( 395345.62 - 396191.06 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 114
0.1% Error 11407
0.1 Scale Factor Error with Delta=300 3970554
0.05 Scale Factor Error with Delta=300 15882218
0.01 Scale Factor Error with Delta=300 397055460
Priority Target DPS
Sample Data Faelik Priority Target Damage Per Second
Count 9999
Mean 269968.87
Minimum 240403.41
Maximum 303130.84
Spread ( max - min ) 62727.43
Range [ ( max - min ) / 2 * 100% ] 11.62%
Standard Deviation 7864.7958
5th Percentile 257233.41
95th Percentile 283353.65
( 95th Percentile - 5th Percentile ) 26120.24
Mean Distribution
Standard Deviation 78.6519
95.00% Confidence Intervall ( 269814.71 - 270123.02 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 32
0.1% Error 3260
0.1 Scale Factor Error with Delta=300 528029
0.05 Scale Factor Error with Delta=300 2112119
0.01 Scale Factor Error with Delta=300 52802997
DPS(e)
Sample Data Faelik Damage Per Second (Effective)
Count 9999
Mean 395768.34
Minimum 338148.65
Maximum 481535.24
Spread ( max - min ) 143386.59
Range [ ( max - min ) / 2 * 100% ] 18.11%
Damage
Sample Data Faelik Damage
Count 9999
Mean 155028252.39
Minimum 120664861.88
Maximum 188458682.61
Spread ( max - min ) 67793820.72
Range [ ( max - min ) / 2 * 100% ] 21.86%
DTPS
Sample Data Faelik Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Faelik Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Faelik Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Faelik Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Faelik Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Faelik Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data FaelikTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Faelik Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
5 0.00 shadowform,if=!buff.shadowform.up
6 0.00 mind_blast
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
0.00 variable,op=set,name=actors_fight_time_mod,value=0
0.00 variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
0.00 variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
0.00 variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
0.00 variable,op=min,name=s2mcheck,value=180
8 0.00 call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
9 0.00 call_action_list,name=vf,if=buff.voidform.up
A 0.00 call_action_list,name=main
actions.main
# count action,conditions
0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
0.00 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
0.00 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
B 2.15 shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
C 1.17 vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
D 10.91 void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
0.00 shadow_crash,if=talent.shadow_crash.enabled
0.00 mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
E 1.94 shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
0.00 vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
F 1.08 shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
0.00 shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
G 14.59 mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
0.00 mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
H 26.75 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
I 6.98 mind_sear,if=active_enemies>=3,interrupt=1,chain=1
J 10.51 mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
0.00 mind_spike,if=talent.mind_spike.enabled
K 15.04 shadow_word_pain
actions.vf
# count action,conditions
0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
0.00 shadow_crash,if=talent.shadow_crash.enabled
0.00 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
0.00 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
L 3.55 power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
0.00 power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
0.00 berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
0.00 berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
M 19.11 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
N 0.80 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
O 1.11 void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
0.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
P 70.44 void_bolt
Q 6.75 void_torrent,if=!talent.surrender_to_madness.enabled
0.00 void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
R 2.01 shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
0.00 shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
S 45.91 mind_blast
0.00 wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
T 4.54 shadow_word_death,if=cooldown.shadow_word_death.charges=2
U 2.36 shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
0.00 shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
V 0.01 shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
W 0.08 vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
X 14.04 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
Y 27.04 mind_sear,if=active_enemies>=3,interrupt=1
Z 33.80 mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
0.00 mind_spike,if=talent.mind_spike.enabled
a 27.88 shadow_word_pain

Sample Sequence

012456BCJGJBJDaQOSZMaLaMSXMXXMUaMSPYPSPYPSPYPSPaaPSZPZKKKGHHHHHIEEDSYPYSPYPSZPQaPSZMaaMSXHHHGIEDYPYSPYPSZPZPSaMaaGHHHHHIGDYaPYPSZPZPQMSLXMXXMSXMXYPSYPYSPYPSZPZPSZPJGKKKHHHGHDXYNYSPYPSYPYPSZPQMaaMaGHHHHIGDYPYPSYPZPSZPUZMaKGHKHHHIGDYPYPSZPaZPSQMaLaMSXMXXMaSPYPSYPYPSYPZPSKJGKKKKHHGHEDXXPaSPYPSYPYSPZPQPSZPRJGJKJFGDZPZPSZPTZPSZPZPRRGJKG7JDZPSTPQPSLZPZPSTPZPSZPZ

Sample Sequence Table

time name target resources buffs
Pre flask Faelik 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre food Faelik 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre augmentation Faelik 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
Pre shadowform Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
0:00.000 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity potion_of_deadly_grace
0:00.000 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity potion_of_deadly_grace
0:01.184 vampiric_touch Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.0/100: 15% insanity bloodlust, potion_of_deadly_grace
0:02.140 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 19.0/100: 19% insanity bloodlust, potion_of_deadly_grace
0:06.665 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.0/100: 37% insanity bloodlust, potion_of_deadly_grace
0:07.618 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.0/100: 53% insanity bloodlust, potion_of_deadly_grace
0:10.296 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.0/100: 63% insanity bloodlust, potion_of_deadly_grace
0:11.251 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.0/100: 66% insanity bloodlust, potion_of_deadly_grace
0:12.467 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity bloodlust, raid_movement, potion_of_deadly_grace
0:12.467 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity bloodlust, raid_movement, sphere_of_insanity, voidform, insanity_drain_stacks, potion_of_deadly_grace
0:13.411 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.9/100: 67% insanity bloodlust, sphere_of_insanity, voidform, insanity_drain_stacks, potion_of_deadly_grace
0:17.610 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.1/100: 73% insanity bloodlust, sphere_of_insanity, voidform(6), insanity_drain_stacks(2), potion_of_deadly_grace
0:18.509 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.9/100: 81% insanity bloodlust, sphere_of_insanity, voidform(7), insanity_drain_stacks(3), potion_of_deadly_grace
0:19.403 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.9/100: 84% insanity bloodlust, sphere_of_insanity, voidform(7), insanity_drain_stacks(3), potion_of_deadly_grace
0:20.441 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 75.4/100: 75% insanity bloodlust, raid_movement, sphere_of_insanity, voidform(8), insanity_drain_stacks(4), potion_of_deadly_grace
0:21.316 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.1/100: 82% insanity bloodlust, raid_movement, sphere_of_insanity, voidform(9), insanity_drain_stacks(5), potion_of_deadly_grace
0:22.184 power_infusion Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.2/100: 79% insanity bloodlust, raid_movement, sphere_of_insanity, voidform(10), insanity_drain_stacks(6), potion_of_deadly_grace
0:22.184 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.2/100: 79% insanity bloodlust, raid_movement, power_infusion, sphere_of_insanity, voidform(10), insanity_drain_stacks(6), potion_of_deadly_grace
0:22.934 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 74.2/100: 74% insanity bloodlust, raid_movement, power_infusion, sphere_of_insanity, voidform(11), insanity_drain_stacks(7), potion_of_deadly_grace
0:23.686 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.2/100: 95% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(12), insanity_drain_stacks(8)
0:24.440 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 98.8/100: 99% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(12), insanity_drain_stacks(8)
0:25.186 void_bolt Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 94.0/100: 94% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(13), insanity_drain_stacks(9)
0:25.935 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 90.2/100: 90% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(14), insanity_drain_stacks(10)
0:26.688 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 90.2/100: 90% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(15), insanity_drain_stacks(11)
0:27.441 void_bolt Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 89.7/100: 90% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(15), insanity_drain_stacks(11)
0:28.187 shadowfiend Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.5/100: 89% insanity bloodlust, raid_movement, power_infusion, sphere_of_insanity, voidform(16), insanity_drain_stacks(12)
0:28.939 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.5/100: 78% insanity bloodlust, raid_movement, power_infusion, sphere_of_insanity, voidform(17), insanity_drain_stacks(13)
0:29.694 void_bolt Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 71.0/100: 71% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(18), insanity_drain_stacks(14)
0:30.450 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.7/100: 80% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(18), insanity_drain_stacks(14)
0:31.617 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.6/100: 76% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(20), insanity_drain_stacks(16)
0:32.371 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.6/100: 84% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(20), insanity_drain_stacks(16)
0:33.498 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.9/100: 95% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(22), insanity_drain_stacks(18), mind_sear_on_hit_reset
0:34.263 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.3/100: 87% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(22), insanity_drain_stacks(18), mind_sear_on_hit_reset
0:35.368 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.7/100: 92% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(23), insanity_drain_stacks(19)
0:36.117 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.4/100: 87% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(24), insanity_drain_stacks(20)
0:37.191 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.2/100: 95% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(25), insanity_drain_stacks(21), mind_sear_on_hit_reset
0:37.951 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.7/100: 91% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(26), insanity_drain_stacks(22), mind_sear_on_hit_reset
0:39.007 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.2/100: 90% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(27), insanity_drain_stacks(23)
0:39.758 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.0/100: 85% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(28), insanity_drain_stacks(24)
0:40.795 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.7/100: 79% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(29), insanity_drain_stacks(25), mind_sear_on_hit_reset
0:41.710 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.8/100: 85% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(30), insanity_drain_stacks(26), mind_sear_on_hit_reset
0:43.220 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.4/100: 72% insanity twist_of_fate, sphere_of_insanity, voidform(31), insanity_drain_stacks(27)
0:44.162 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.6/100: 77% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(32), insanity_drain_stacks(28)
0:45.098 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.1/100: 58% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(33), insanity_drain_stacks(29)
0:46.024 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.2/100: 39% insanity twist_of_fate, sphere_of_insanity, voidform(34), insanity_drain_stacks(30)
0:46.946 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.0/100: 38% insanity twist_of_fate, sphere_of_insanity, voidform(35), insanity_drain_stacks(31)
0:47.866 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 28.4/100: 28% insanity twist_of_fate, sphere_of_insanity, voidform(36), insanity_drain_stacks(32)
0:48.777 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 9.3/100: 9% insanity twist_of_fate, sphere_of_insanity, voidform(37), insanity_drain_stacks(33)
0:49.680 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 6.8/100: 7% insanity twist_of_fate, sphere_of_insanity, voidform(38), insanity_drain_stacks(34)
0:50.907 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/100: 4% insanity raid_movement, lingering_insanity(38)
0:51.806 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 7.0/100: 7% insanity raid_movement, lingering_insanity(38)
0:52.705 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 10.0/100: 10% insanity raid_movement, lingering_insanity(38)
0:53.605 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 13.0/100: 13% insanity lingering_insanity(38)
0:54.503 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 25.0/100: 25% insanity lingering_insanity(38)
0:55.402 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 29.0/100: 29% insanity lingering_insanity(38)
0:56.302 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 33.0/100: 33% insanity lingering_insanity(38)
0:57.203 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 41.0/100: 41% insanity lingering_insanity(38)
0:58.100 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 45.0/100: 45% insanity lingering_insanity(38)
0:58.999 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.0/100: 53% insanity lingering_insanity(38)
1:00.218 shadow_word_pain Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 71.0/100: 71% insanity raid_movement, lingering_insanity(38), mind_sear_on_hit_reset
1:01.116 shadow_word_pain Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity raid_movement, lingering_insanity(38), mind_sear_on_hit_reset
1:02.013 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.0/100: 81% insanity lingering_insanity(38), mind_sear_on_hit_reset
1:02.013 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.0/100: 81% insanity sphere_of_insanity, voidform, lingering_insanity(38), insanity_drain_stacks, mind_sear_on_hit_reset
1:02.903 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.3/100: 85% insanity sphere_of_insanity, voidform, lingering_insanity(38), insanity_drain_stacks
1:04.434 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.5/100: 97% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(38), insanity_drain_stacks(3), mind_sear_on_hit_reset
1:05.304 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.5/100: 92% insanity twist_of_fate, sphere_of_insanity, voidform(4), lingering_insanity(38), insanity_drain_stacks(4), mind_sear_on_hit_reset
1:06.683 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.3/100: 97% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(38), insanity_drain_stacks(5), mind_sear_on_hit_reset
1:07.539 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(38), insanity_drain_stacks(6), mind_sear_on_hit_reset
1:08.383 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.3/100: 94% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(38), insanity_drain_stacks(7), mind_sear_on_hit_reset, burning_intensity
1:09.875 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.2/100: 95% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(38), insanity_drain_stacks(8), mind_sear_on_hit_reset, burning_intensity(2)
1:11.188 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.9/100: 89% insanity twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mind_sear_on_hit_reset, burning_intensity(4)
1:12.316 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.6/100: 94% insanity twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(11), mind_sear_on_hit_reset, burning_intensity(5)
1:13.431 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.2/100: 90% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12), burning_intensity(6)
1:14.534 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(13), burning_intensity(7)
1:16.184 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.0/100: 85% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(14), burning_intensity(9)
1:17.259 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(15), burning_intensity(10)
1:18.324 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.5/100: 78% insanity twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(16), burning_intensity(11)
1:19.384 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.3/100: 73% insanity twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(17), burning_intensity(12)
1:20.557 void_bolt Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 55.7/100: 56% insanity raid_movement, sphere_of_insanity, voidform(19), insanity_drain_stacks(18), burning_intensity(13)
1:21.593 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.3/100: 53% insanity raid_movement, sphere_of_insanity, voidform(20), insanity_drain_stacks(19), burning_intensity(14)
1:22.622 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.4/100: 37% insanity raid_movement, sphere_of_insanity, voidform(21), insanity_drain_stacks(20), burning_intensity(15)
1:23.641 void_bolt Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 29.7/100: 30% insanity sphere_of_insanity, voidform(22), insanity_drain_stacks(21), burning_intensity(16)
1:24.650 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 26.7/100: 27% insanity sphere_of_insanity, voidform(23), insanity_drain_stacks(22), burning_intensity(17)
1:25.658 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 19.1/100: 19% insanity sphere_of_insanity, voidform(24), insanity_drain_stacks(23), burning_intensity(18)
1:26.658 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 4.0/100: 4% insanity lingering_insanity(25), burning_intensity(19)
1:27.650 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(25), burning_intensity(20)
1:28.641 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity lingering_insanity(25)
1:29.634 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 28.0/100: 28% insanity lingering_insanity(25)
1:30.629 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.0/100: 40% insanity lingering_insanity(25)
1:32.155 shadow_word_pain Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 71.0/100: 71% insanity raid_movement, lingering_insanity(25), mind_sear_on_hit_reset
1:33.149 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity lingering_insanity(25), mind_sear_on_hit_reset
1:33.149 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity sphere_of_insanity, voidform, lingering_insanity(25), insanity_drain_stacks, mind_sear_on_hit_reset
1:35.096 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.9/100: 83% insanity twist_of_fate, sphere_of_insanity, voidform(2), lingering_insanity(25), insanity_drain_stacks(2), mind_sear_on_hit_reset
1:36.060 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.9/100: 89% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(25), insanity_drain_stacks(3), mind_sear_on_hit_reset
1:37.621 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.9/100: 95% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(25), insanity_drain_stacks(5), mind_sear_on_hit_reset
1:38.566 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(25), insanity_drain_stacks(6), mind_sear_on_hit_reset
1:39.499 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.0/100: 92% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(25), insanity_drain_stacks(7), mind_sear_on_hit_reset
1:41.330 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.6/100: 73% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(9), mind_sear_on_hit_reset
1:42.506 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.0/100: 77% insanity twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mind_sear_on_hit_reset
1:43.635 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.1/100: 74% insanity twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(11), mind_sear_on_hit_reset
1:44.751 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.0/100: 66% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12)
1:45.852 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.9/100: 70% insanity twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(13)
1:48.313 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.9/100: 42% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(16)
1:49.381 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.9/100: 45% insanity twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(17)
1:50.438 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.0/100: 27% insanity raid_movement, sphere_of_insanity, voidform(18), insanity_drain_stacks(18)
1:51.486 void_bolt Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 19.8/100: 20% insanity raid_movement, sphere_of_insanity, voidform(19), insanity_drain_stacks(19)
1:52.523 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 17.0/100: 17% insanity raid_movement, sphere_of_insanity, voidform(20), insanity_drain_stacks(20)
1:53.554 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.6/100: 1% insanity raid_movement, sphere_of_insanity, voidform(21), insanity_drain_stacks(21)
1:54.579 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity lingering_insanity(21)
1:55.605 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(21)
1:56.631 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity lingering_insanity(21)
1:57.658 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity lingering_insanity(21)
1:58.685 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity lingering_insanity(21)
1:59.711 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 28.0/100: 28% insanity lingering_insanity(21)
2:00.735 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity lingering_insanity(21)
2:02.293 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.0/100: 63% insanity lingering_insanity(21), mind_sear_on_hit_reset
2:03.318 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.0/100: 79% insanity lingering_insanity(21), mind_sear_on_hit_reset
2:03.318 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.0/100: 79% insanity sphere_of_insanity, voidform, lingering_insanity(21), insanity_drain_stacks, mind_sear_on_hit_reset
2:04.556 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.2/100: 77% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(2), lingering_insanity(21), insanity_drain_stacks(2), mind_sear_on_hit_reset
2:05.557 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.9/100: 79% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(21), insanity_drain_stacks(3), mind_sear_on_hit_reset
2:06.549 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.9/100: 93% insanity twist_of_fate, sphere_of_insanity, voidform(4), lingering_insanity(21), insanity_drain_stacks(4), mind_sear_on_hit_reset
2:08.497 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.2/100: 90% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(21), insanity_drain_stacks(6), mind_sear_on_hit_reset
2:09.464 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.4/100: 93% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(21), insanity_drain_stacks(7), mind_sear_on_hit_reset
2:10.420 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.4/100: 93% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(21), insanity_drain_stacks(8), mind_sear_on_hit_reset
2:11.378 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.9/100: 90% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(9), mind_sear_on_hit_reset
2:12.514 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.3/100: 90% insanity twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(10)
2:15.052 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.4/100: 63% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12)
2:16.154 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.2/100: 63% insanity twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(13)
2:20.216 void_bolt Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 64.2/100: 64% insanity raid_movement, sphere_of_insanity, voidform(17), insanity_drain_stacks(13)
2:21.266 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.4/100: 64% insanity sphere_of_insanity, voidform(18), insanity_drain_stacks(14)
2:22.317 power_infusion Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.7/100: 64% insanity sphere_of_insanity, voidform(19), insanity_drain_stacks(15)
2:22.317 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 63.7/100: 64% insanity power_infusion, sphere_of_insanity, voidform(19), insanity_drain_stacks(15)
2:23.151 void_bolt Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 55.1/100: 55% insanity power_infusion, sphere_of_insanity, voidform(20), insanity_drain_stacks(16)
2:23.973 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 60.8/100: 61% insanity power_infusion, sphere_of_insanity, voidform(21), insanity_drain_stacks(17)
2:24.795 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 52.2/100: 52% insanity power_infusion, sphere_of_insanity, voidform(22), insanity_drain_stacks(18)
2:25.609 void_bolt Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 48.3/100: 48% insanity power_infusion, sphere_of_insanity, voidform(23), insanity_drain_stacks(19)
2:26.415 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.9/100: 59% insanity power_infusion, sphere_of_insanity, voidform(24), insanity_drain_stacks(20)
2:27.216 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 59.5/100: 59% insanity power_infusion, sphere_of_insanity, voidform(24), insanity_drain_stacks(20)
2:28.016 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 49.4/100: 49% insanity power_infusion, sphere_of_insanity, voidform(25), insanity_drain_stacks(21)
2:28.807 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 54.2/100: 54% insanity power_infusion, sphere_of_insanity, voidform(26), insanity_drain_stacks(22)
2:29.596 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 43.7/100: 44% insanity power_infusion, sphere_of_insanity, voidform(27), insanity_drain_stacks(23)
2:30.929 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.4/100: 55% insanity power_infusion, sphere_of_insanity, voidform(28), insanity_drain_stacks(24), mind_sear_on_hit_reset
2:31.703 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.0/100: 60% insanity power_infusion, sphere_of_insanity, voidform(29), insanity_drain_stacks(25), mind_sear_on_hit_reset, burning_intensity
2:32.472 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.2/100: 58% insanity power_infusion, sphere_of_insanity, voidform(30), insanity_drain_stacks(26), mind_sear_on_hit_reset, burning_intensity
2:33.710 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.1/100: 55% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(31), insanity_drain_stacks(27), mind_sear_on_hit_reset, burning_intensity(3)
2:34.466 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.6/100: 69% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(32), insanity_drain_stacks(28), mind_sear_on_hit_reset, burning_intensity(3)
2:35.679 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.2/100: 73% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(33), insanity_drain_stacks(29), mind_sear_on_hit_reset, burning_intensity(5)
2:36.433 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.0/100: 61% insanity raid_movement, power_infusion, twist_of_fate, sphere_of_insanity, voidform(34), insanity_drain_stacks(30), mind_sear_on_hit_reset, burning_intensity(5)
2:37.186 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.7/100: 64% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(34), insanity_drain_stacks(30), mind_sear_on_hit_reset, burning_intensity(6)
2:38.632 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.5/100: 57% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(36), insanity_drain_stacks(32), mind_sear_on_hit_reset, burning_intensity(8)
2:39.385 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.4/100: 68% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(37), insanity_drain_stacks(33), mind_sear_on_hit_reset, burning_intensity(8)
2:40.140 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.7/100: 65% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(37), insanity_drain_stacks(33), mind_sear_on_hit_reset, burning_intensity(9)
2:40.890 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.9/100: 61% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(38), insanity_drain_stacks(34), mind_sear_on_hit_reset, burning_intensity(10)
2:41.642 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.8/100: 67% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(39), insanity_drain_stacks(35), mind_sear_on_hit_reset, burning_intensity(11)
2:43.402 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.7/100: 38% insanity twist_of_fate, sphere_of_insanity, voidform(41), insanity_drain_stacks(37), burning_intensity(12)
2:44.281 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 33.4/100: 33% insanity twist_of_fate, sphere_of_insanity, voidform(41), insanity_drain_stacks(37), burning_intensity(13)
2:45.163 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 26.5/100: 26% insanity twist_of_fate, sphere_of_insanity, voidform(42), insanity_drain_stacks(38), burning_intensity(14)
2:46.038 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 5.4/100: 5% insanity twist_of_fate, sphere_of_insanity, voidform(43), insanity_drain_stacks(39), burning_intensity(15)
2:46.901 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity twist_of_fate, lingering_insanity(44), burning_intensity(16)
2:49.654 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity lingering_insanity(44), burning_intensity(19)
2:50.516 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity raid_movement, lingering_insanity(44), burning_intensity(19)
2:51.378 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 19.0/100: 19% insanity raid_movement, lingering_insanity(44), burning_intensity(20)
2:52.240 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.0/100: 30% insanity raid_movement, lingering_insanity(44)
2:53.102 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 33.0/100: 33% insanity lingering_insanity(44)
2:53.964 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 41.0/100: 41% insanity lingering_insanity(44)
2:54.827 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 53.0/100: 53% insanity lingering_insanity(44)
2:55.690 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.0/100: 57% insanity lingering_insanity(44)
2:56.553 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 69.0/100: 69% insanity lingering_insanity(44)
2:57.417 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.0/100: 73% insanity lingering_insanity(44)
2:57.417 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 73.0/100: 73% insanity sphere_of_insanity, voidform, lingering_insanity(44), insanity_drain_stacks
2:58.272 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.3/100: 73% insanity sphere_of_insanity, voidform, lingering_insanity(44), insanity_drain_stacks
2:59.698 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 87.4/100: 87% insanity sphere_of_insanity, voidform(3), lingering_insanity(44), insanity_drain_stacks(3), mind_sear_on_hit_reset
3:00.532 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.5/100: 97% insanity sphere_of_insanity, voidform(4), lingering_insanity(44), insanity_drain_stacks(4), mind_sear_on_hit_reset
3:01.889 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.3/100: 97% insanity sphere_of_insanity, voidform(5), lingering_insanity(44), insanity_drain_stacks(5), mind_sear_on_hit_reset
3:02.710 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity sphere_of_insanity, voidform(6), lingering_insanity(44), insanity_drain_stacks(6), mind_sear_on_hit_reset
3:03.522 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.5/100: 91% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(44), insanity_drain_stacks(7), mind_sear_on_hit_reset
3:04.864 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.9/100: 97% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(44), insanity_drain_stacks(8), mind_sear_on_hit_reset
3:06.125 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.6/100: 87% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(9), mind_sear_on_hit_reset
3:07.263 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.3/100: 84% insanity twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mind_sear_on_hit_reset
3:08.605 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.6/100: 66% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12), mind_sear_on_hit_reset
3:09.710 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.9/100: 66% insanity twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(13), mind_sear_on_hit_reset
3:11.878 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.4/100: 39% insanity twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(15), mind_sear_on_hit_reset
3:12.950 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.6/100: 43% insanity twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(16), mind_sear_on_hit_reset
3:14.020 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.3/100: 44% insanity twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(17), mind_sear_on_hit_reset
3:15.080 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.5/100: 34% insanity twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(18)
3:16.125 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.9/100: 32% insanity twist_of_fate, sphere_of_insanity, voidform(19), insanity_drain_stacks(19)
3:20.362 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 29.6/100: 30% insanity raid_movement, sphere_of_insanity, voidform(23), insanity_drain_stacks(19)
3:21.363 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.6/100: 28% insanity raid_movement, sphere_of_insanity, voidform(24), insanity_drain_stacks(20)
3:22.355 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 11.6/100: 12% insanity raid_movement, sphere_of_insanity, voidform(25), insanity_drain_stacks(21)
3:23.339 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 3.6/100: 4% insanity raid_movement, sphere_of_insanity, voidform(26), insanity_drain_stacks(22)
3:24.316 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.7/100: 1% insanity raid_movement, sphere_of_insanity, voidform(27), insanity_drain_stacks(23)
3:25.286 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity lingering_insanity(28)
3:26.255 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity lingering_insanity(28)
3:27.224 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity lingering_insanity(28)
3:28.192 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity lingering_insanity(28)
3:29.161 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 28.0/100: 28% insanity lingering_insanity(28)
3:30.130 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity lingering_insanity(28)
3:32.336 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.0/100: 68% insanity lingering_insanity(28), mind_sear_on_hit_reset
3:33.306 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity lingering_insanity(28), mind_sear_on_hit_reset
3:33.306 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity sphere_of_insanity, voidform, lingering_insanity(28), insanity_drain_stacks, mind_sear_on_hit_reset
3:35.209 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.9/100: 81% insanity twist_of_fate, sphere_of_insanity, voidform(2), lingering_insanity(28), insanity_drain_stacks(2), mind_sear_on_hit_reset
3:36.151 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.9/100: 88% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(28), insanity_drain_stacks(3), mind_sear_on_hit_reset
3:37.996 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.7/100: 87% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(28), insanity_drain_stacks(5), mind_sear_on_hit_reset
3:38.915 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.2/100: 96% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(28), insanity_drain_stacks(6), mind_sear_on_hit_reset
3:39.829 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.7/100: 98% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(28), insanity_drain_stacks(7), mind_sear_on_hit_reset
3:40.952 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.4/100: 87% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(28), insanity_drain_stacks(8), mind_sear_on_hit_reset
3:41.994 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.7/100: 87% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(9), mind_sear_on_hit_reset
3:44.528 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.3/100: 64% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12), mind_sear_on_hit_reset
3:45.632 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.5/100: 69% insanity twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(13)
3:46.727 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.0/100: 64% insanity twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(14)
3:47.814 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.0/100: 55% insanity twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(15)
3:48.887 shadowfiend Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.2/100: 54% insanity twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(16)
3:49.950 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.7/100: 37% insanity sphere_of_insanity, voidform(17), insanity_drain_stacks(17)
3:51.224 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 14.6/100: 15% insanity raid_movement, sphere_of_insanity, voidform(18), insanity_drain_stacks(18)
3:52.265 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 11.8/100: 12% insanity raid_movement, sphere_of_insanity, voidform(19), insanity_drain_stacks(19)
3:53.298 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity raid_movement, lingering_insanity(20)
3:54.332 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/100: 3% insanity lingering_insanity(20)
3:55.365 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 19.0/100: 19% insanity lingering_insanity(20)
3:56.397 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 19.0/100: 19% insanity raid_movement, lingering_insanity(20)
3:57.430 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 22.0/100: 22% insanity lingering_insanity(20)
3:58.463 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 30.0/100: 30% insanity lingering_insanity(20)
3:59.497 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 34.0/100: 34% insanity lingering_insanity(20)
4:00.531 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.0/100: 38% insanity lingering_insanity(20)
4:02.158 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.0/100: 65% insanity lingering_insanity(20), mind_sear_on_hit_reset
4:03.193 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.0/100: 77% insanity lingering_insanity(20), mind_sear_on_hit_reset
4:03.193 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.0/100: 77% insanity sphere_of_insanity, voidform, lingering_insanity(20), insanity_drain_stacks, mind_sear_on_hit_reset
4:05.221 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.9/100: 81% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(20), insanity_drain_stacks(3), mind_sear_on_hit_reset
4:06.222 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.9/100: 91% insanity twist_of_fate, sphere_of_insanity, voidform(4), lingering_insanity(20), insanity_drain_stacks(4), mind_sear_on_hit_reset
4:08.189 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.4/100: 88% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(20), insanity_drain_stacks(5), mind_sear_on_hit_reset
4:09.163 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.9/100: 97% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(20), insanity_drain_stacks(6), mind_sear_on_hit_reset, burning_intensity
4:10.139 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.5/100: 97% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(20), insanity_drain_stacks(7), mind_sear_on_hit_reset, burning_intensity
4:11.106 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.5/100: 89% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(20), insanity_drain_stacks(8), mind_sear_on_hit_reset, burning_intensity(2)
4:12.223 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.7/100: 86% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(10), burning_intensity(4)
4:13.349 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.6/100: 74% insanity twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(11), burning_intensity(5)
4:14.463 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.2/100: 66% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12), burning_intensity(6)
4:15.566 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.4/100: 70% insanity twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(13), burning_intensity(7)
4:16.662 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.9/100: 70% insanity twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(14), burning_intensity(8)
4:20.218 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 70.8/100: 71% insanity raid_movement, sphere_of_insanity, voidform(18), insanity_drain_stacks(15), burning_intensity(12)
4:21.268 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.0/100: 70% insanity raid_movement, sphere_of_insanity, voidform(19), insanity_drain_stacks(16), burning_intensity(13)
4:22.308 power_infusion Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.1/100: 60% insanity raid_movement, sphere_of_insanity, voidform(20), insanity_drain_stacks(17), burning_intensity(14)
4:22.317 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.1/100: 60% insanity raid_movement, power_infusion, sphere_of_insanity, voidform(20), insanity_drain_stacks(17), burning_intensity(14)
4:23.143 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 50.2/100: 50% insanity raid_movement, power_infusion, sphere_of_insanity, voidform(20), insanity_drain_stacks(17), burning_intensity(14)
4:23.965 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.8/100: 56% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(21), insanity_drain_stacks(18), burning_intensity(15)
4:24.784 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 56.6/100: 57% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(22), insanity_drain_stacks(19), burning_intensity(16)
4:25.599 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 51.3/100: 51% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(23), insanity_drain_stacks(20), burning_intensity(17)
4:26.404 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 61.6/100: 62% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(24), insanity_drain_stacks(21), burning_intensity(18)
4:27.205 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 51.4/100: 51% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(25), insanity_drain_stacks(22), burning_intensity(19)
4:27.999 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 41.2/100: 41% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(25), insanity_drain_stacks(22), burning_intensity(19)
4:28.788 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.4/100: 46% insanity raid_movement, power_infusion, twist_of_fate, sphere_of_insanity, voidform(26), insanity_drain_stacks(23), burning_intensity(20)
4:29.573 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.1/100: 34% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(27), insanity_drain_stacks(24)
4:30.356 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.9/100: 33% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(28), insanity_drain_stacks(25)
4:31.132 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.2/100: 37% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(28), insanity_drain_stacks(25)
4:32.656 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 47.9/100: 48% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(30), insanity_drain_stacks(27), mind_sear_on_hit_reset
4:33.417 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.4/100: 61% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(31), insanity_drain_stacks(28), mind_sear_on_hit_reset
4:34.174 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.9/100: 60% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(31), insanity_drain_stacks(28), mind_sear_on_hit_reset
4:35.418 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.6/100: 54% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(33), insanity_drain_stacks(30), mind_sear_on_hit_reset
4:36.172 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.4/100: 56% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(33), insanity_drain_stacks(30), mind_sear_on_hit_reset
4:37.443 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.9/100: 54% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(35), insanity_drain_stacks(32), mind_sear_on_hit_reset
4:38.384 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.9/100: 61% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(36), insanity_drain_stacks(33), mind_sear_on_hit_reset
4:39.139 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.1/100: 57% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(36), insanity_drain_stacks(33), mind_sear_on_hit_reset
4:40.386 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.8/100: 39% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(38), insanity_drain_stacks(35), mind_sear_on_hit_reset
4:41.140 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.3/100: 44% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(38), insanity_drain_stacks(35), mind_sear_on_hit_reset
4:42.759 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 14.3/100: 14% insanity twist_of_fate, sphere_of_insanity, voidform(40), insanity_drain_stacks(37), mind_sear_on_hit_reset
4:43.642 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 7.4/100: 7% insanity twist_of_fate, sphere_of_insanity, voidform(41), insanity_drain_stacks(38), mind_sear_on_hit_reset
4:44.521 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity raid_movement, twist_of_fate, lingering_insanity(41)
4:45.399 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 7.0/100: 7% insanity twist_of_fate, lingering_insanity(41)
4:49.566 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 29.0/100: 29% insanity twist_of_fate, lingering_insanity(41)
4:50.447 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 29.0/100: 29% insanity raid_movement, twist_of_fate, lingering_insanity(41)
4:51.328 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity raid_movement, twist_of_fate, lingering_insanity(41)
4:52.208 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.0/100: 39% insanity raid_movement, twist_of_fate, lingering_insanity(41)
4:53.089 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.0/100: 42% insanity raid_movement, twist_of_fate, lingering_insanity(41)
4:53.969 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 45.0/100: 45% insanity twist_of_fate, lingering_insanity(41)
4:54.849 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 53.0/100: 53% insanity twist_of_fate, lingering_insanity(41)
4:55.728 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.0/100: 57% insanity twist_of_fate, lingering_insanity(41)
4:56.610 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 69.0/100: 69% insanity twist_of_fate, lingering_insanity(41)
4:57.490 shadow_word_pain Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 73.0/100: 73% insanity twist_of_fate, lingering_insanity(41)
4:58.371 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity twist_of_fate, lingering_insanity(41)
4:58.371 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity twist_of_fate, sphere_of_insanity, voidform, lingering_insanity(41), insanity_drain_stacks
4:59.242 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 76.3/100: 76% insanity twist_of_fate, sphere_of_insanity, voidform, lingering_insanity(41), insanity_drain_stacks
5:00.105 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.7/100: 69% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(2), lingering_insanity(41), insanity_drain_stacks(2)
5:00.962 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.4/100: 76% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(41), insanity_drain_stacks(3)
5:01.811 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.9/100: 71% insanity twist_of_fate, sphere_of_insanity, voidform(4), lingering_insanity(41), insanity_drain_stacks(4)
5:02.658 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.1/100: 74% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(41), insanity_drain_stacks(5)
5:03.493 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.8/100: 81% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(41), insanity_drain_stacks(6)
5:05.136 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.9/100: 93% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(41), insanity_drain_stacks(7), mind_sear_on_hit_reset
5:05.951 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.0/100: 94% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(41), insanity_drain_stacks(8), mind_sear_on_hit_reset
5:06.920 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.1/100: 94% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(9)
5:08.644 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.9/100: 95% insanity twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(11), mind_sear_on_hit_reset
5:09.759 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.6/100: 89% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12), mind_sear_on_hit_reset
5:11.521 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.9/100: 70% insanity twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(14), mind_sear_on_hit_reset
5:12.609 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.2/100: 65% insanity twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(15), mind_sear_on_hit_reset
5:13.685 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.6/100: 64% insanity twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(16), mind_sear_on_hit_reset
5:16.166 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.6/100: 35% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(18)
5:17.209 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.9/100: 32% insanity twist_of_fate, sphere_of_insanity, voidform(19), insanity_drain_stacks(19)
5:21.473 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.5/100: 30% insanity twist_of_fate, sphere_of_insanity, voidform(24), insanity_drain_stacks(20)
5:22.472 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.4/100: 32% insanity twist_of_fate, sphere_of_insanity, voidform(25), insanity_drain_stacks(21)
5:23.466 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 26.3/100: 26% insanity twist_of_fate, sphere_of_insanity, voidform(26), insanity_drain_stacks(22)
5:24.451 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 11.2/100: 11% insanity twist_of_fate, sphere_of_insanity, voidform(27), insanity_drain_stacks(23)
5:25.427 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 7.2/100: 7% insanity twist_of_fate, sphere_of_insanity, voidform(28), insanity_drain_stacks(24)
5:26.396 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity twist_of_fate, lingering_insanity(28)
5:28.045 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 10.0/100: 10% insanity twist_of_fate, lingering_insanity(28)
5:29.015 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 26.0/100: 26% insanity twist_of_fate, lingering_insanity(28)
5:32.253 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.0/100: 42% insanity raid_movement, twist_of_fate, lingering_insanity(28)
5:33.222 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 45.0/100: 45% insanity twist_of_fate, lingering_insanity(28)
5:34.924 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.0/100: 59% insanity twist_of_fate, lingering_insanity(28)
5:35.895 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.0/100: 69% insanity twist_of_fate, lingering_insanity(28)
5:36.865 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.0/100: 85% insanity twist_of_fate, lingering_insanity(28)
5:36.865 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.0/100: 85% insanity twist_of_fate, sphere_of_insanity, voidform, lingering_insanity(28), insanity_drain_stacks
5:39.028 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.4/100: 73% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(28), insanity_drain_stacks(3)
5:39.968 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.9/100: 80% insanity twist_of_fate, sphere_of_insanity, voidform(4), lingering_insanity(28), insanity_drain_stacks(4)
5:42.104 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.7/100: 66% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(28), insanity_drain_stacks(6)
5:43.016 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.1/100: 75% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(28), insanity_drain_stacks(7)
5:43.922 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.3/100: 76% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(28), insanity_drain_stacks(8)
5:44.820 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.5/100: 69% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(28), insanity_drain_stacks(8)
5:45.944 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.2/100: 75% insanity twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(10)
5:47.069 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.9/100: 70% insanity twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(11)
5:48.410 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.7/100: 54% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12)
5:49.512 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.7/100: 58% insanity twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(13)
5:50.610 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.2/100: 53% insanity twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(14)
5:51.696 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 43.8/100: 44% insanity twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(15)
5:52.766 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.2/100: 46% insanity twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(16)
5:55.203 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 13.1/100: 13% insanity twist_of_fate, sphere_of_insanity, voidform(19), insanity_drain_stacks(19)
5:56.241 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 10.2/100: 10% insanity twist_of_fate, sphere_of_insanity, voidform(20), insanity_drain_stacks(20)
5:57.272 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.9/100: 5% insanity twist_of_fate, sphere_of_insanity, voidform(21), insanity_drain_stacks(21)
5:58.295 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity twist_of_fate, lingering_insanity(22)
5:59.312 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity twist_of_fate, lingering_insanity(22)
6:04.242 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.0/100: 38% insanity raid_movement, twist_of_fate, lingering_insanity(22)
6:05.257 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.0/100: 41% insanity twist_of_fate, lingering_insanity(22)
6:06.401 potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.0/100: 53% insanity twist_of_fate, lingering_insanity(22)
6:06.401 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.0/100: 53% insanity twist_of_fate, lingering_insanity(22), potion_of_deadly_grace
6:11.340 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.0/100: 79% insanity twist_of_fate, lingering_insanity(22), potion_of_deadly_grace
6:11.340 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.0/100: 79% insanity twist_of_fate, sphere_of_insanity, voidform, lingering_insanity(22), insanity_drain_stacks, potion_of_deadly_grace
6:13.568 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.9/100: 71% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(22), insanity_drain_stacks(3), potion_of_deadly_grace
6:14.554 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.9/100: 77% insanity twist_of_fate, sphere_of_insanity, voidform(4), lingering_insanity(22), insanity_drain_stacks(4), potion_of_deadly_grace
6:15.533 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.2/100: 83% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(22), insanity_drain_stacks(5), potion_of_deadly_grace
6:16.500 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.2/100: 82% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(22), insanity_drain_stacks(6), potion_of_deadly_grace
6:17.458 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.7/100: 88% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(22), insanity_drain_stacks(7), potion_of_deadly_grace
6:20.295 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.1/100: 88% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(7), potion_of_deadly_grace
6:21.421 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.7/100: 87% insanity twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(9), potion_of_deadly_grace
6:22.538 power_infusion Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.4/100: 84% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(10), potion_of_deadly_grace
6:22.538 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.4/100: 84% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(10), potion_of_deadly_grace
6:23.424 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.6/100: 78% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(11), potion_of_deadly_grace
6:24.302 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.0/100: 85% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(11), potion_of_deadly_grace
6:26.255 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.7/100: 67% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(13), potion_of_deadly_grace
6:27.112 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.0/100: 79% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(14), potion_of_deadly_grace
6:27.969 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.6/100: 81% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(15), potion_of_deadly_grace
6:28.813 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.5/100: 79% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(16), potion_of_deadly_grace
6:29.653 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.5/100: 86% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(19), insanity_drain_stacks(17), potion_of_deadly_grace
6:31.576 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.0/100: 63% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(21), insanity_drain_stacks(19)
6:32.395 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.7/100: 73% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(22), insanity_drain_stacks(20)
6:33.210 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.3/100: 78% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(22), insanity_drain_stacks(20)
6:34.024 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.2/100: 68% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(23), insanity_drain_stacks(21)
6:34.827 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.0/100: 73% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(24), insanity_drain_stacks(22)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6253 5928 0
Agility 7827 7502 0
Stamina 32888 32888 20425
Intellect 32385 30679 21893 (801)
Spirit 5 5 0
Health 1973280 1973280 0
Mana 1100000 1100000 0
Insanity 100 100 0
Spell Power 32385 30679 0
Crit 27.43% 27.43% 7850
Haste 21.41% 20.25% 6582
Damage / Heal Versatility 0.73% 0.73% 290
ManaReg per Second 8800 8800 0
Mastery 43.75% 43.75% 3325
Armor 1635 1635 1635
Run Speed 7 0 0
Leech 2.48% 2.48% 570

Gear

Source Slot Average Item Level: 856.00
Local Head Hood of Ancient Evil
ilevel: 855, stats: { 215 Armor, +1359 Int, +2039 Sta, +836 Crit, +494 Mastery, +570 Leech }
Local Neck Chain of the Underking
ilevel: 870, stats: { +1319 Sta, +1188 Crit, +791 Mastery }
Local Shoulders Shoulderpads of Crashing Waves
ilevel: 855, stats: { 199 Armor, +1019 Int, +1529 Sta, +627 Mastery, +370 Crit }
Local Chest Fluxflow Robes
ilevel: 850, stats: { 260 Armor, +1297 Int, +1945 Sta, +876 Haste, +428 Crit, +559 Avoidance }
Local Waist Roggthread Cord
ilevel: 860, stats: { 152 Armor, +1068 Int, +1601 Sta, +726 Haste, +290 Vers }
Local Legs Ragged Horrorweave Leggings
ilevel: 850, stats: { 228 Armor, +1945 Sta, +1297 Int, +736 Haste, +568 Mastery }
Local Feet Cozy Dryad Hoof-Socks
ilevel: 850, stats: { 179 Armor, +1459 Sta, +973 Int, +658 Haste, +322 Crit }
Local Wrists Sunfrost Wristwraps
ilevel: 840, stats: { 110 Armor, +665 Int, +997 Sta, +490 Haste, +217 Crit, +379 unknown }
Local Hands Ink-Smudged Handwraps
ilevel: 840, stats: { 157 Armor, +886 Int, +1329 Sta, +552 Mastery, +391 Haste }
Local Finger1 Twice-Warped Azsharan Signet
ilevel: 850, stats: { +1094 Sta, +1258 Crit, +577 Haste }, gems: { +150 Haste }, enchant: { +150 Haste }
Local Finger2 Sephuz's Secret
ilevel: 895, stats: { +1665 Sta, +620 Haste, +1552 Crit }, enchant: { +150 Haste }
Local Trinket1 Nightborne Researcher's Phial
ilevel: 835, stats: { +1073 Int, +882 Crit }, gems: { +200 Int }
Local Trinket2 Infernal Writ
ilevel: 840, stats: { +1123 Int }
Local Back Evergreen Vinewrap Drape
ilevel: 860, stats: { 135 Armor, +801 StrAgiInt, +1201 Sta, +512 Haste, +250 Crit }, enchant: { +150 Int }
Local Main Hand Xal'atath, Blade of the Black Empire
ilevel: 869, weapon: { 1361 - 2530, 1.8 }, stats: { +664 Int, +996 Sta, +305 Crit, +293 Mastery, +8447 Int }, relics: { +37 ilevels, +40 ilevels, +42 ilevels }
Local Off Hand Secrets of the Void
ilevel: 869, stats: { +871 Int, +1306 Sta, +546 Haste, +242 Crit }
Local Tabard Renowned Guild Tabard
ilevel: 1

Talents

Level
15 Twist of Fate (Shadow Priest) Fortress of the Mind (Shadow Priest) Shadow Word: Void (Shadow Priest)
30 Mania (Shadow Priest) Body and Soul Masochism
45 Mind Bomb (Shadow Priest) Psychic Voice Dominant Mind
60 Void Lord (Shadow Priest) Reaper of Souls (Shadow Priest) Void Ray (Shadow Priest)
75 San'layn (Shadow Priest) Auspicious Spirits (Shadow Priest) Shadowy Insight (Shadow Priest)
90 Power Infusion (Shadow Priest) Shadow Crash (Shadow Priest) Mindbender (Shadow Priest)
100 Legacy of the Void (Shadow Priest) Mind Spike (Shadow Priest) Surrender to Madness (Shadow Priest)

Profile

priest="Faelik"
origin="https://us.api.battle.net/wow/character/thrall/Faelik/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/187/153787323-avatar.jpg"
level=110
race=undead
role=spell
position=back
professions=alchemy=503/herbalism=800
talents=1211211
artifact=47:0:0:0:0:764:1:765:1:766:1:767:3:769:1:770:1:771:3:772:3:773:3:775:3:776:3:777:2:1347:1
spec=shadow

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/mind_blast

# Executed every time the actor is available.
actions=potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
actions+=/variable,op=set,name=actors_fight_time_mod,value=0
actions+=/variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
actions+=/variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
actions+=/variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
actions+=/variable,op=min,name=s2mcheck,value=180
actions+=/call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
actions+=/call_action_list,name=vf,if=buff.voidform.up
actions+=/call_action_list,name=main

actions.main=surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
actions.main+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
actions.main+=/shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
actions.main+=/vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
actions.main+=/void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
actions.main+=/shadow_crash,if=talent.shadow_crash.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
actions.main+=/shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
actions.main+=/shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
actions.main+=/mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
actions.main+=/mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.main+=/shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
actions.main+=/mind_sear,if=active_enemies>=3,interrupt=1,chain=1
actions.main+=/mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
actions.main+=/mind_spike,if=talent.mind_spike.enabled
actions.main+=/shadow_word_pain

actions.s2m=shadow_crash,if=talent.shadow_crash.enabled
actions.s2m+=/mindbender,if=talent.mindbender.enabled
actions.s2m+=/dispersion,if=!buff.power_infusion.up&!buff.berserking.up&!buff.bloodlust.up
actions.s2m+=/power_infusion,if=buff.insanity_drain_stacks.stack>=85
actions.s2m+=/berserking,if=buff.voidform.stack>=90
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt
actions.s2m+=/void_torrent
actions.s2m+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.s2m+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+90)<100
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.s2m+=/mind_blast
actions.s2m+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.s2m+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.s2m+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.s2m+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+75)<100
actions.s2m+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.s2m+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.s2m+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.s2m+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.s2m+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.s2m+=/mind_spike,if=talent.mind_spike.enabled

actions.vf=surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
actions.vf+=/shadow_crash,if=talent.shadow_crash.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
actions.vf+=/berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
actions.vf+=/berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt
actions.vf+=/void_torrent,if=!talent.surrender_to_madness.enabled
actions.vf+=/void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
actions.vf+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
actions.vf+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.vf+=/mind_blast
actions.vf+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.vf+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.vf+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.vf+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
actions.vf+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.vf+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.vf+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.vf+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.vf+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.vf+=/mind_spike,if=talent.mind_spike.enabled
actions.vf+=/shadow_word_pain

head=hood_of_ancient_evil,id=134425,bonus_id=1727/41/1507/3337
neck=chain_of_the_underking,id=134495,bonus_id=3414/1522/3337
shoulders=shoulderpads_of_crashing_waves,id=137360,bonus_id=3411/1507/3336
back=evergreen_vinewrap_drape,id=139248,bonus_id=3379/1482/3337,enchant=150int
chest=fluxflow_robes,id=134413,bonus_id=3410/40/1502/3336
tabard=renowned_guild_tabard,id=69210
wrists=sunfrost_wristwraps,id=139130,bonus_id=1727/43/1502/1813
hands=inksmudged_handwraps,id=134421,bonus_id=1727/1492/1813
waist=roggthread_cord,id=134171,bonus_id=3410/1522/3337
legs=ragged_horrorweave_leggings,id=139190,bonus_id=1807/1472
feet=cozy_dryad_hoofsocks,id=139194,bonus_id=1807/1472
finger1=twicewarped_azsharan_signet,id=139238,bonus_id=1807/1808/1472,gems=150haste,enchant=150haste
finger2=sephuzs_secret,id=132452,bonus_id=1811,enchant=150haste
trinket1=nightborne_researchers_phial,id=134292,bonus_id=3432/1808/603/1497/1674,gems=200int
trinket2=infernal_writ,id=137485,bonus_id=1727/1492/1813
main_hand=xalatath_blade_of_the_black_empire,id=128827,bonus_id=740,gem_id=141254/141264/137347/0,relic_id=3397:1492:1675/3432:1502:3336/3411:1497:1813/0
off_hand=secrets_of_the_void,id=133958

# Gear Summary
# gear_ilvl=855.50
# gear_stamina=20425
# gear_intellect=21893
# gear_crit_rating=7850
# gear_haste_rating=6582
# gear_mastery_rating=3325
# gear_versatility_rating=290
# gear_leech_rating=570
# gear_avoidance_rating=559
# gear_armor=1635

Raji

Raji : 358140 dps, 247245 dps to main target

  • Race: Troll
  • Class: Priest
  • Spec: Shadow
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
358140.1 358140.1 302.9 / 0.085% 59251.7 / 16.5% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.66% 48.2 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Raji/advanced
Talents
  • 15: Twist of Fate (Shadow Priest)
  • 30: Body and Soul
  • 45: Mind Bomb (Shadow Priest)
  • 60: Reaper of Souls (Shadow Priest)
  • 75: Auspicious Spirits (Shadow Priest)
  • 90: Mindbender (Shadow Priest)
  • 100: Legacy of the Void (Shadow Priest)
  • Talent Calculator
Artifact
Professions
  • tailoring: 755
  • enchanting: 714
Scale Factors for Raji Damage Per Second
Int Haste Crit Vers Mastery
Scale Factors 10.72 9.52 9.25 8.84 8.03
Normalized 1.00 0.89 0.86 0.82 0.75
Scale Deltas 1138 1138 1138 1138 1138
Error 0.38 0.38 0.38 0.38 0.38
Gear Ranking
Optimizers
Ranking
  • Int > Haste ~= Crit > Vers > Mastery
Pawn string ( Pawn: v1: "Raji": Intellect=10.72, CritRating=9.25, HasteRating=9.52, MasteryRating=8.03, Versatility=8.84 )

Scale Factors for other metrics

Scale Factors for Raji Damage Per Second
Int Haste Crit Vers Mastery
Scale Factors 10.72 9.52 9.25 8.84 8.03
Normalized 1.00 0.89 0.86 0.82 0.75
Scale Deltas 1138 1138 1138 1138 1138
Error 0.38 0.38 0.38 0.38 0.38
Gear Ranking
Optimizers
Ranking
  • Int > Haste ~= Crit > Vers > Mastery
Pawn string ( Pawn: v1: "Raji": Intellect=10.72, CritRating=9.25, HasteRating=9.52, MasteryRating=8.03, Versatility=8.84 )
Scale Factors for Raji Priority Target Damage Per Second
Int Crit Haste Vers Mastery
Scale Factors 7.87 7.35 7.18 6.09 5.75
Normalized 1.00 0.93 0.91 0.77 0.73
Scale Deltas 1138 1138 1138 1138 1138
Error 0.13 0.13 0.13 0.13 0.13
Gear Ranking
Optimizers
Ranking
  • Int > Crit > Haste > Vers > Mastery
Pawn string ( Pawn: v1: "Raji": Intellect=7.87, CritRating=7.35, HasteRating=7.18, MasteryRating=5.75, Versatility=6.09 )
Scale Factors for Raji Damage Per Second (Effective)
Int Haste Crit Vers Mastery
Scale Factors 10.72 9.52 9.25 8.84 8.03
Normalized 1.00 0.89 0.86 0.82 0.75
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Int > Haste > Crit > Vers > Mastery
Pawn string ( Pawn: v1: "Raji": Intellect=10.72, CritRating=9.25, HasteRating=9.52, MasteryRating=8.03, Versatility=8.84 )
Scale Factors for Raji Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Raji Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Raji Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Raji Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Raji Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Raji Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Raji Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for RajiTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Raji 358140
Deadly Grace 9441 2.6% 28.7 14.53sec 130192 0 Direct 28.6 98070 196219 130301 32.8%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.67 28.65 0.00 0.00 0.0000 0.0000 3732927.02 3732927.02 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.24 67.16% 98069.84 89490 107388 98058.60 91727 105598 1887011 1887011 0.00
crit 9.41 32.84% 196218.77 178979 214775 196225.65 178979 214775 1845916 1845916 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Mind Blast 21570 6.0% 48.4 8.21sec 178609 161697 Direct 49.4 131895 263718 174996 32.7%  

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.41 49.41 0.00 0.00 1.1046 0.0000 8646091.69 8646091.69 0.00 161696.84 161696.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.25 67.31% 131895.45 97832 152618 131909.81 120506 141496 4386071 4386071 0.00
crit 16.15 32.69% 263717.82 195665 305237 263759.49 225192 305237 4260020 4260020 0.00
 
 

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage.$?a185916[ |cFFFFFFFFGenerates {$/100;s2=12} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mind Flay 13236 3.8% 47.7 8.44sec 113321 71863 Periodic 126.3 32265 64539 42812 32.7% 16.3%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.73 0.00 126.34 126.34 1.5769 0.5174 5409018.98 5409018.98 0.00 71863.46 71863.46
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 85.1 67.32% 32264.52 23433 36631 32199.72 29398 34211 2744234 2744234 0.00
crit 41.3 32.68% 64538.64 46865 73261 64412.16 57482 71383 2664785 2664785 0.00
 
 

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.mind_spike.enabled
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}$?s120585[. Each time Mind Flay deals damage, the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]$?a185916[ |cFFFFFFFFGenerates ${4*$m3/100} Insanity over the duration.|r][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.550000
  • base_td:1.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Mind Sear 38993 10.8% 28.1 10.19sec 548754 311623 Periodic 405.3 28717 57439 38100 32.7% 10.5%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.14 0.00 71.09 405.26 1.7610 0.5900 15440296.11 15440296.11 0.00 311622.99 311622.99
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 272.9 67.33% 28716.60 22092 34464 28738.94 26935 31195 7835822 7835822 0.00
crit 132.4 32.67% 57439.23 44185 68928 57484.70 53134 63292 7604474 7604474 0.00
 
 

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing Shadow damage to all targets within $49821a2 yards.
  • description:Corrosive shadow energy radiates from the target, dealing ${$49821m2*6} Shadow damage over {$48045d=5 seconds} to all enemies within $49821a2 yards of the target. |cFFFFFFFFGenerates ${$208232m1*6/100} Insanity over the duration per target hit.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a2 yards.
  • description:{$@spelldesc48045=Corrosive shadow energy radiates from the target, dealing ${$49821m2*6} Shadow damage over {$48045d=5 seconds} to all enemies within $49821a2 yards of the target. |cFFFFFFFFGenerates ${$208232m1*6/100} Insanity over the duration per target hit.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.540000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Shadow Word: Death 8456 2.4% 14.0 10.16sec 240999 225460 Direct 14.0 181487 363034 240998 32.8%  

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.00 14.00 0.00 0.00 1.0690 0.0000 3375140.66 3375140.66 0.00 225460.30 225460.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.41 67.22% 181486.59 119090 185780 181537.74 152435 185780 1708504 1708504 0.00
crit 4.59 32.78% 363033.90 238180 371560 361563.57 0 371560 1666637 1666637 0.00
 
 

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=1} Shadow damage to the target. Only usable on enemies that have less than {$s2=20}% health. |cFFFFFFFFGenerates {$s3=10} Insanity, or $/100;190714s1 if the target dies.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.250000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Shadow Word: Pain 43723 12.2% 41.5 9.40sec 421027 414177 Direct 41.5 33917 67771 45000 32.7%  
Periodic 296.5 39702 79415 52681 32.7% 103.1%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.55 41.55 296.54 296.54 1.0166 1.3935 17491932.27 17491932.27 0.00 38404.22 414176.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.95 67.26% 33916.53 26348 41103 33927.62 31172 37678 947805 947805 0.00
crit 13.60 32.74% 67770.52 52697 82207 67786.33 56913 78782 921713 921713 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 199.6 67.32% 39702.13 224 45113 39710.27 38521 40987 7925376 7925376 0.00
crit 96.9 32.68% 79414.58 546 90227 79414.60 75113 83884 7697038 7697038 0.00
 
 

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<(3+(4%3))*gcd
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A word of darkness that causes {$s1=1} Shadow damage instantly, and an additional $o2 Shadow damage over {$d=14 seconds}.$?a185916[ |cFFFFFFFFGenerates ${$m3/100} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.410000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.450000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Shadowy Apparitions 14704 4.1% 167.2 2.36sec 35139 0 Direct 165.8 26718 53448 35454 32.7%  

Stats details: shadowy_apparitions

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 167.24 165.76 0.00 0.00 0.0000 0.0000 5876637.49 5876637.49 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 111.59 67.32% 26718.31 19566 30524 26722.18 25098 28218 2981414 2981414 0.00
crit 54.17 32.68% 53447.82 39133 61047 53458.17 48268 57979 2895223 2895223 0.00
 
 

Action details: shadowy_apparitions

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=0} Shadow damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.275000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Vampiric Touch 79882 22.3% 33.9 9.02sec 940721 879176 Periodic 358.7 66916 133893 88785 32.7% 187.6%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.86 0.00 358.73 358.73 1.0700 2.0966 31849896.41 31849896.41 0.00 40401.63 879175.65
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 241.6 67.35% 66916.33 69 77183 66936.16 64687 69387 16167308 16167308 0.00
crit 117.1 32.65% 133893.20 210 154366 133925.98 127017 141203 15682589 15682589 0.00
 
 

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.vampiric_touch.remains<(4+(4%3))*gcd
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A touch of darkness that causes $34914o2 Shadow damage over {$34914d=18 seconds}, and heals the Priest for ${$e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates ${$m3/100} Insanity.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.790000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Void Bolt 49626 13.9% 81.3 4.80sec 244322 230956 Direct 81.1 184681 369415 245121 32.7%  

Stats details: void_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.34 81.08 0.00 0.00 1.0579 0.0000 19873791.17 19873791.17 0.00 230956.32 230956.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.55 67.28% 184680.97 125253 195395 184669.02 178372 190479 10074429 10074429 0.00
crit 26.53 32.72% 369414.53 250506 390790 369418.99 349342 390790 9799363 9799363 0.00
 
 

Action details: void_bolt

Static Values
  • id:205448
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10
Spelldata
  • id:205448
  • name:Void Bolt
  • school:shadow
  • tooltip:
  • description:Sends a bolt of pure void energy at the enemy, causing {$s1=1} Shadow damage$?a231688[ and refreshing Shadow Word: Pain and Vampiric Touch to their original duration][]. Requires Voidform. |cFFFFFFFFGenerates {$/100;s3=16} Insanity.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Eruption 10010 2.8% 11.5 35.43sec 347439 0 Direct 50.5 59826 119641 79354 32.7%  

Stats details: void_eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.53 50.49 0.00 0.00 0.0000 0.0000 4006966.03 4006966.03 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.01 67.35% 59825.56 53364 64037 59831.29 54432 64037 2034515 2034515 0.00
crit 16.49 32.65% 119640.63 106728 128074 119650.91 106728 128074 1972451 1972451 0.00
 
 

Action details: void_eruption

Static Values
  • id:228360
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:18.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
Spelldata
  • id:228360
  • name:Void Eruption
  • school:shadow
  • tooltip:
  • description:{$@spelldesc228260=Releases an explosive blast of pure void energy, activating Voidform and causing {$228360s1=1} Shadow damage to all enemies afflicted by your Shadow Word: Pain or Vampiric Touch. During Voidform, this ability is replaced by Void Bolt. |cFFFFFFFFRequires ${$C/100} Insanity to activate.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Torrent 15271 4.3% 6.9 61.24sec 883049 238991 Periodic 42.5 108537 217019 143933 32.6% 5.9%

Stats details: void_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.93 0.00 42.50 42.50 3.6949 0.5548 6117224.73 6117224.73 0.00 238991.43 238991.43
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.6 67.37% 108537.35 519 122096 108522.09 96089 121079 3107746 3107746 0.00
crit 13.9 32.63% 217018.90 1246 244193 217084.07 131552 244193 3009478 3009478 0.00
 
 

Action details: void_torrent

Static Values
  • id:205065
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205065
  • name:Void Torrent
  • school:shadow
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:2.200000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Volatile Ichor 31664 8.8% 22.0 18.02sec 571526 0 Direct 74.3 127206 254482 168888 32.7%  

Stats details: volatile_ichor

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.95 74.28 0.00 0.00 0.0000 0.0000 12545110.40 12545110.40 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.95 67.25% 127206.11 117119 140543 127304.54 118420 140074 6354434 6354434 0.00
crit 24.33 32.75% 254481.72 234238 281085 254671.82 234238 281085 6190676 6190676 0.00
 
 

Action details: volatile_ichor

Static Values
  • id:222187
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222187
  • name:Volatile Ichor
  • school:physical
  • tooltip:
  • description:Your ranged attacks and spells have a chance to summon a Volatile Ichor, which creeps towards the target and explodes on contact, dealing {$s1=65033} Nature damage within $222197A1 yards.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:103616.84
  • base_dd_max:103616.84
 
pet - mindbender 61588 / 16171
melee 61588 4.5% 91.1 4.27sec 71057 64289 Direct 91.1 53606 107207 71057 32.6%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.05 91.05 0.00 0.00 1.1053 0.0000 6469957.63 6469957.63 0.00 64288.77 64288.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.41 67.44% 53605.73 47561 54695 53604.95 52713 54426 3291910 3291910 0.00
crit 29.64 32.56% 107207.02 95121 109390 107205.58 103147 109390 3178048 3178048 0.00
 
 

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
pet - void_tendril 30176 / 4798
Mind Flay (_void_tendril) 30176 (32711) 1.4% (2.1%) 9.2 40.61sec 325577 64648 Periodic 46.2 31708 63416 42065 32.7% 11.5%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.18 0.00 46.24 46.24 5.0362 1.0000 1945162.18 1945162.18 0.00 64647.94 64647.94
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.1 67.34% 31708.14 31708 31708 31708.14 31708 31708 987303 987303 0.00
crit 15.1 32.66% 63416.28 63416 63416 63409.93 0 63416 957859 957859 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 30794 0.3% 2.0 61.56sec 210159 42084 Periodic 9.9 31708 63416 42083 32.7% 2.5%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.99 0.00 9.93 9.93 4.9943 1.0000 417808.88 417808.88 0.00 42083.89 42083.89
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.7 67.29% 31708.14 31708 31708 31469.34 0 31708 211846 211846 0.00
crit 3.2 32.71% 63416.28 63416 63416 59758.54 0 63416 205963 205963 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 32699 0.2% 1.3 10.47sec 241411 42280 Periodic 7.6 31708 63416 42280 33.3% 1.9%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.33 0.00 7.59 7.59 5.7098 1.0000 321076.60 321076.60 0.00 42280.30 42280.30
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.1 66.66% 31708.14 31708 31708 31391.06 0 31708 160507 160507 0.00
crit 2.5 33.34% 63416.28 63416 63416 58723.47 0 63416 160570 160570 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 33033 0.2% 1.3 4.83sec 242474 40218 Periodic 7.6 31708 63416 40215 26.8% 1.9%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.26 0.00 7.59 7.59 6.0294 1.0000 305337.62 305337.62 0.00 40218.34 40218.34
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.6 73.17% 31708.14 31708 31708 30533.76 0 31708 176156 176156 0.00
crit 2.0 26.83% 63416.28 63416 63416 56370.02 0 63416 129181 129181 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Raji
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Raji
  • harmful:false
  • if_expr:
 
Berserking 2.6 186.24sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.57 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.voidform.stack>=90
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Raji
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Raji
  • harmful:false
  • if_expr:
 
Mindbender 7.1 60.47sec

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.12 0.00 0.00 0.00 1.1183 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: mindbender

Static Values
  • id:200174
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled&!talent.surrender_to_madness.enabled
Spelldata
  • id:200174
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Summons a Mindbender to attack the target for {$d=15 seconds}. |cFFFFFFFFGenerates {$s3=4} Insanity each time the Mindbender attacks.|r
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shadowform 1.0 0.00sec

Stats details: shadowform

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowform

Static Values
  • id:232698
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.shadowform.up
Spelldata
  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Shadow damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your Shadow damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
 
pet - mindbender
Shadowcrawl 21.1 18.93sec

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.09 0.00 0.00 0.00 1.1243 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Berserking 2.6 0.0 186.1sec 186.1sec 6.29% 8.09% 0.0(0.0) 2.5

Buff details

  • buff initial source:Raji
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.12% 11.45% 0.0(0.0) 1.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
insanity_drain_stacks 11.5 269.5 35.4sec 35.4sec 74.42% 74.42% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_insanity_drain_stacks
  • max_stacks:999
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • insanity_drain_stacks_1:3.66%
  • insanity_drain_stacks_2:2.94%
  • insanity_drain_stacks_3:2.87%
  • insanity_drain_stacks_4:3.05%
  • insanity_drain_stacks_5:3.42%
  • insanity_drain_stacks_6:3.33%
  • insanity_drain_stacks_7:3.09%
  • insanity_drain_stacks_8:3.38%
  • insanity_drain_stacks_9:3.46%
  • insanity_drain_stacks_10:3.11%
  • insanity_drain_stacks_11:2.96%
  • insanity_drain_stacks_12:3.04%
  • insanity_drain_stacks_13:3.04%
  • insanity_drain_stacks_14:3.06%
  • insanity_drain_stacks_15:2.89%
  • insanity_drain_stacks_16:2.85%
  • insanity_drain_stacks_17:2.76%
  • insanity_drain_stacks_18:2.72%
  • insanity_drain_stacks_19:2.66%
  • insanity_drain_stacks_20:2.41%
  • insanity_drain_stacks_21:2.10%
  • insanity_drain_stacks_22:1.86%
  • insanity_drain_stacks_23:1.60%
  • insanity_drain_stacks_24:1.34%
  • insanity_drain_stacks_25:1.20%
  • insanity_drain_stacks_26:1.05%
  • insanity_drain_stacks_27:0.87%
  • insanity_drain_stacks_28:0.80%
  • insanity_drain_stacks_29:0.72%
  • insanity_drain_stacks_30:0.60%
  • insanity_drain_stacks_31:0.54%
  • insanity_drain_stacks_32:0.45%
  • insanity_drain_stacks_33:0.32%
  • insanity_drain_stacks_34:0.16%
  • insanity_drain_stacks_35:0.05%
  • insanity_drain_stacks_36:0.02%
  • insanity_drain_stacks_37:0.00%
  • insanity_drain_stacks_38:0.00%
  • insanity_drain_stacks_39:0.00%
  • insanity_drain_stacks_40:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%
Lingering Insanity 11.5 0.0 33.8sec 33.8sec 23.53% 23.53% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_lingering_insanity
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lingering_insanity_13:0.00%
  • lingering_insanity_14:0.00%
  • lingering_insanity_15:0.00%
  • lingering_insanity_16:0.04%
  • lingering_insanity_17:0.24%
  • lingering_insanity_18:0.36%
  • lingering_insanity_19:1.43%
  • lingering_insanity_20:2.64%
  • lingering_insanity_21:1.50%
  • lingering_insanity_22:0.78%
  • lingering_insanity_23:0.41%
  • lingering_insanity_24:0.53%
  • lingering_insanity_25:0.83%
  • lingering_insanity_26:1.72%
  • lingering_insanity_27:1.65%
  • lingering_insanity_28:1.48%
  • lingering_insanity_29:1.35%
  • lingering_insanity_30:0.79%
  • lingering_insanity_31:0.52%
  • lingering_insanity_32:0.53%
  • lingering_insanity_33:0.61%
  • lingering_insanity_34:0.80%
  • lingering_insanity_35:0.92%
  • lingering_insanity_36:1.63%
  • lingering_insanity_37:1.49%
  • lingering_insanity_38:0.77%
  • lingering_insanity_39:0.31%
  • lingering_insanity_40:0.13%
  • lingering_insanity_41:0.04%
  • lingering_insanity_42:0.01%
  • lingering_insanity_43:0.01%
  • lingering_insanity_44:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197937
  • name:Lingering Insanity
  • tooltip:Haste increased by $w1%.
  • description:{$@spelldesc194249={$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing all damage you deal by {$194249s1=30}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and granting an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you return to normal Shadowform, and you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}}
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
mind_sear_on_hit_reset 11.7 16.5 25.6sec 10.2sec 26.37% 26.37% 0.0(0.0) 11.5

Buff details

  • buff initial source:Raji
  • cooldown name:buff_mind_sear_on_hit_reset
  • max_stacks:2
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • mind_sear_on_hit_reset_1:26.37%

Trigger Attempt Success

  • trigger_pct:100.00%
Potion of Deadly Grace 2.0 0.0 364.7sec 0.0sec 12.15% 12.15% 0.0(0.0) 2.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:12.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 14.52% 14.52% 2.0(2.0) 0.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.52%

Trigger Attempt Success

  • trigger_pct:100.00%
Twist of Fate 8.6 406.2 29.5sec 0.9sec 62.87% 62.87% 406.2(406.2) 7.6

Buff details

  • buff initial source:Raji
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • twist_of_fate_1:62.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After {$?s15407=true}[damaging][healing] a target below {$s1=35}% health, you deal {$123254s2=20}% increased damage and {$123254s1=20}% increased healing for {$123254d=10 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Void Torrent 6.9 0.0 61.2sec 61.2sec 6.05% 6.05% 0.0(0.0) 5.2

Buff details

  • buff initial source:Raji
  • cooldown name:buff_void_torrent
  • max_stacks:1
  • duration:4.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • void_torrent_1:6.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205065
  • name:Void Torrent
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
  • max_stacks:0
  • duration:4.00
  • cooldown:60.00
  • default_chance:0.00%
Voidform 11.5 0.0 35.4sec 35.4sec 74.42% 67.57% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_voidform
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • voidform_1:2.87%
  • voidform_2:2.86%
  • voidform_3:2.86%
  • voidform_4:2.85%
  • voidform_5:2.84%
  • voidform_6:2.84%
  • voidform_7:2.83%
  • voidform_8:2.82%
  • voidform_9:2.82%
  • voidform_10:2.81%
  • voidform_11:2.80%
  • voidform_12:2.80%
  • voidform_13:2.79%
  • voidform_14:2.78%
  • voidform_15:2.78%
  • voidform_16:2.77%
  • voidform_17:2.75%
  • voidform_18:2.71%
  • voidform_19:2.63%
  • voidform_20:2.38%
  • voidform_21:2.15%
  • voidform_22:2.04%
  • voidform_23:1.96%
  • voidform_24:1.89%
  • voidform_25:1.79%
  • voidform_26:1.57%
  • voidform_27:1.30%
  • voidform_28:1.09%
  • voidform_29:0.90%
  • voidform_30:0.76%
  • voidform_31:0.68%
  • voidform_32:0.63%
  • voidform_33:0.57%
  • voidform_34:0.50%
  • voidform_35:0.42%
  • voidform_36:0.32%
  • voidform_37:0.17%
  • voidform_38:0.08%
  • voidform_39:0.03%
  • voidform_40:0.01%
  • voidform_41:0.00%
  • voidform_42:0.00%
  • voidform_43:0.00%
  • voidform_44:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194249
  • name:Voidform
  • tooltip:Cooldown on Mind Blast reduced by ${$w6/1000} sec. Shadow damage dealt increased by $w1%. Haste increased by $w3%. Losing ${$w2/500} Insanity every sec.
  • description:{$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing all damage you deal by {$194249s1=30}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and granting an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you return to normal Shadowform, and you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}
  • max_stacks:100
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
mindbender: raid_movement 0.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:0.00%

Trigger Attempt Success

  • trigger_pct:0.01%
mindbender: Shadowcrawl 21.1 0.0 18.9sec 18.9sec 86.69% 84.71% 0.0(0.0) 14.0

Buff details

  • buff initial source:Raji_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadowcrawl_1:86.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:0
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
void_tendril: raid_movement 4.0 0.0 68.9sec 68.9sec 19.43% 19.43% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji_void_tendril
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:19.43%

Trigger Attempt Success

  • trigger_pct:100.00%
void_tendril: raid_movement 0.7 0.0 126.5sec 126.5sec 16.55% 16.55% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji_void_tendril
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:16.56%

Trigger Attempt Success

  • trigger_pct:56.56%
void_tendril: raid_movement 0.3 0.0 0.0sec 0.0sec 11.39% 11.39% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji_void_tendril
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:11.52%

Trigger Attempt Success

  • trigger_pct:32.60%
void_tendril: raid_movement 0.3 0.0 0.0sec 0.0sec 9.26% 9.26% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji_void_tendril
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:13.15%

Trigger Attempt Success

  • trigger_pct:25.93%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Raji
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Raji
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Raji
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Shadowform

Buff details

  • buff initial source:Raji
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:232698
  • name:Shadowform
  • tooltip:Shadow damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your Shadow damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Raji
Resource Gains Type Count Total Average Overflow
Insanity Gained from Auspicious Spirits Insanity 165.75 620.23 (1093.15%) 3.74 42.79 6.45%
Insanity Drained by Voidform Insanity 5962.93 -4381.19 (-7721.85%) -0.73 0.00 -0.00%
Insanity Gained from Mind Blast Insanity 49.41 586.55 (1033.79%) 11.87 6.35 1.07%
Insanity Gained from Mind Flay Insanity 126.34 252.66 (445.31%) 2.00 0.03 0.01%
Insanity Gained from Mind Sear Insanity 405.26 591.82 (1043.09%) 1.46 16.06 2.64%
Insanity Gained from Mindbender Insanity 91.05 315.42 (555.93%) 3.46 48.79 13.40%
Insanity Gained from Shadow Word: Death Insanity 14.00 372.84 (657.13%) 26.62 47.31 11.26%
Insanity Gained from Shadow Word: Pain Casts Insanity 41.55 123.80 (218.20%) 2.98 0.84 0.67%
Insanity Gained from Vampiric Touch Casts Insanity 33.86 135.14 (238.18%) 3.99 0.29 0.21%
Insanity Gained from Void Bolt Insanity 81.34 1129.19 (1990.20%) 13.88 172.29 13.24%
Insanity Saved by Void Torrent Insanity 483.52 310.29 (546.88%) 0.64 0.00 0.00%
Health from Vampiric Touch Ticks Health 358.73 0.00 (0.00%) 0.00 15925056.88 100.00%
mp5_regen Mana 662.51 0.00 (0.00%) 0.00 3523327.40 100.00%
Resource RPS-Gain RPS-Loss
Insanity 11.07 10.93
Combat End Resource Mean Min Max
Mana 1100000.00 1100000.00 1100000.00
Insanity 57.35 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
Shadowy Apparition Insanity lost to overflow 167.3 2.4sec
Void Eruption casted when a target with both DoTs was up 12.4 35.4sec
Void Eruption casted when a target with no DoTs was up 13.9 56.0sec
Void Eruption casted when a target with only Shadow Word: Pain was up 0.5 211.9sec
Void Eruption casted when a target with only Vampiric Touch was up 25.8 32.7sec
Void Tendril spawned from Call to the Void 7.3 52.8sec

Statistics & Data Analysis

Fight Length
Sample Data Raji Fight Length
Count 9999
Mean 401.00
Minimum 308.02
Maximum 501.87
Spread ( max - min ) 193.85
Range [ ( max - min ) / 2 * 100% ] 24.17%
DPS
Sample Data Raji Damage Per Second
Count 9999
Mean 358140.09
Minimum 318955.67
Maximum 418320.10
Spread ( max - min ) 99364.43
Range [ ( max - min ) / 2 * 100% ] 13.87%
Standard Deviation 15453.4909
5th Percentile 335757.63
95th Percentile 386297.71
( 95th Percentile - 5th Percentile ) 50540.07
Mean Distribution
Standard Deviation 154.5426
95.00% Confidence Intervall ( 357837.20 - 358442.99 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 71
0.1% Error 7152
0.1 Scale Factor Error with Delta=300 2038622
0.05 Scale Factor Error with Delta=300 8154491
0.01 Scale Factor Error with Delta=300 203862276
Priority Target DPS
Sample Data Raji Priority Target Damage Per Second
Count 9999
Mean 247245.18
Minimum 229259.29
Maximum 267870.30
Spread ( max - min ) 38611.02
Range [ ( max - min ) / 2 * 100% ] 7.81%
Standard Deviation 5229.8656
5th Percentile 238621.30
95th Percentile 255806.23
( 95th Percentile - 5th Percentile ) 17184.93
Mean Distribution
Standard Deviation 52.3013
95.00% Confidence Intervall ( 247142.67 - 247347.69 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1718
0.1 Scale Factor Error with Delta=300 233488
0.05 Scale Factor Error with Delta=300 933952
0.01 Scale Factor Error with Delta=300 23348808
DPS(e)
Sample Data Raji Damage Per Second (Effective)
Count 9999
Mean 358140.09
Minimum 318955.67
Maximum 418320.10
Spread ( max - min ) 99364.43
Range [ ( max - min ) / 2 * 100% ] 13.87%
Damage
Sample Data Raji Damage
Count 9999
Mean 134365032.95
Minimum 107215250.85
Maximum 164240877.68
Spread ( max - min ) 57025626.83
Range [ ( max - min ) / 2 * 100% ] 21.22%
DTPS
Sample Data Raji Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Raji Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Raji Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Raji Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Raji Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Raji Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data RajiTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Raji Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
5 0.00 shadowform,if=!buff.shadowform.up
6 0.00 mind_blast
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
0.00 variable,op=set,name=actors_fight_time_mod,value=0
0.00 variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
0.00 variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
0.00 variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
0.00 variable,op=min,name=s2mcheck,value=180
8 0.00 call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
9 0.00 call_action_list,name=vf,if=buff.voidform.up
A 0.00 call_action_list,name=main
actions.main
# count action,conditions
0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
B 4.55 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
0.00 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
C 2.01 shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
D 1.26 vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
E 11.53 void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
0.00 shadow_crash,if=talent.shadow_crash.enabled
0.00 mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
F 1.38 shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
0.00 vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
0.00 shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
G 1.23 shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
H 12.39 mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
0.00 mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
I 19.44 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
J 8.25 mind_sear,if=active_enemies>=3,interrupt=1,chain=1
K 7.79 mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
0.00 mind_spike,if=talent.mind_spike.enabled
L 9.63 shadow_word_pain
actions.vf
# count action,conditions
0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
0.00 shadow_crash,if=talent.shadow_crash.enabled
M 2.79 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
0.00 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
0.00 power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
0.00 power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
N 2.57 berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
0.00 berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
O 21.68 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
P 1.96 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
Q 1.80 void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
0.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
R 55.90 void_bolt
S 6.93 void_torrent,if=!talent.surrender_to_madness.enabled
0.00 void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
0.00 shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
T 4.90 shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
U 40.99 mind_blast
0.00 wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
V 7.87 shadow_word_death,if=cooldown.shadow_word_death.charges=2
0.00 shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
0.00 shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
W 0.02 shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
X 0.20 vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
Y 15.50 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
Z 18.10 mind_sear,if=active_enemies>=3,interrupt=1
a 31.63 mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
0.00 mind_spike,if=talent.mind_spike.enabled
b 28.50 shadow_word_pain

Sample Sequence

012456BCDKHKESPUaRaNRUaObbOUYOYYObbOUZRZRUZRZRUaRaLHKLLLLHIIIIFBBEbUQZRUSRUaRaObbOUYIIIHJLJEZUQZRUaRabRbbOUIIIIIBHJEbZRZSRUaRabOUYOYYOUIJCEbUQaRUaRaObbOUIIIIIBHJEZObZRSRNUaObbObbOUYOYJHJEZQZbRUaRaRbbLHIILIIJBFEUZRZURbSRUbObVOUYObYRTTRUZRZHKLHEaRVbOUYOYYRUMRVZRUZRaRSTRTUKHKEabRUVRaRUaRVaRbURaKGHKEaM7RUVRaRUaRSNRUVRaRUaRaRTURT

Sample Sequence Table

time name target resources buffs
Pre flask Raji 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre food Raji 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre augmentation Raji 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
Pre shadowform Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
0:00.000 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity potion_of_deadly_grace
0:00.000 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity potion_of_deadly_grace
0:01.211 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity bloodlust, potion_of_deadly_grace
0:02.192 vampiric_touch Fluffy_Pillow 1100000.0/1100000: 100% mana | 23.0/100: 23% insanity bloodlust, potion_of_deadly_grace
0:03.174 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.0/100: 31% insanity bloodlust, potion_of_deadly_grace
0:06.268 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.0/100: 59% insanity bloodlust, potion_of_deadly_grace
0:07.248 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity bloodlust, potion_of_deadly_grace
0:09.062 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.0/100: 89% insanity bloodlust, potion_of_deadly_grace
0:09.062 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.0/100: 89% insanity bloodlust, voidform, insanity_drain_stacks, potion_of_deadly_grace
0:12.283 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.3/100: 97% insanity bloodlust, raid_movement, voidform(4), insanity_drain_stacks(2), potion_of_deadly_grace
0:13.225 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.2/100: 95% insanity bloodlust, voidform(5), insanity_drain_stacks(3), potion_of_deadly_grace
0:14.160 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity bloodlust, voidform(6), insanity_drain_stacks(4), potion_of_deadly_grace
0:15.088 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 98.5/100: 98% insanity bloodlust, voidform(7), insanity_drain_stacks(5), potion_of_deadly_grace
0:16.004 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.1/100: 90% insanity bloodlust, voidform(7), insanity_drain_stacks(5), potion_of_deadly_grace
0:18.211 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.8/100: 77% insanity bloodlust, voidform(10), insanity_drain_stacks(8), potion_of_deadly_grace
0:18.211 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.8/100: 77% insanity bloodlust, berserking, voidform(10), insanity_drain_stacks(8), potion_of_deadly_grace
0:18.989 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.2/100: 83% insanity bloodlust, berserking, voidform(10), insanity_drain_stacks(8), potion_of_deadly_grace
0:19.766 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.8/100: 89% insanity bloodlust, berserking, voidform(11), insanity_drain_stacks(9), potion_of_deadly_grace
0:20.760 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 80.5/100: 80% insanity bloodlust, berserking, raid_movement, voidform(12), insanity_drain_stacks(10), potion_of_deadly_grace
0:21.518 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.6/100: 86% insanity bloodlust, berserking, raid_movement, voidform(13), insanity_drain_stacks(11), potion_of_deadly_grace
0:22.271 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.1/100: 78% insanity bloodlust, berserking, raid_movement, voidform(14), insanity_drain_stacks(12), potion_of_deadly_grace
0:23.027 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 74.5/100: 75% insanity bloodlust, berserking, raid_movement, voidform(14), insanity_drain_stacks(12)
0:23.776 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.3/100: 79% insanity bloodlust, berserking, voidform(15), insanity_drain_stacks(13)
0:24.525 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity bloodlust, berserking, voidform(16), insanity_drain_stacks(14)
0:25.278 void_bolt Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 72.6/100: 73% insanity bloodlust, berserking, voidform(17), insanity_drain_stacks(15)
0:26.033 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 76.6/100: 77% insanity bloodlust, berserking, voidform(17), insanity_drain_stacks(15)
0:26.781 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 68.6/100: 69% insanity bloodlust, berserking, voidform(18), insanity_drain_stacks(16)
0:27.533 void_bolt Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 60.1/100: 60% insanity bloodlust, berserking, voidform(19), insanity_drain_stacks(17)
0:28.297 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.3/100: 63% insanity bloodlust, raid_movement, voidform(20), insanity_drain_stacks(18)
0:29.115 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.8/100: 52% insanity bloodlust, raid_movement, voidform(21), insanity_drain_stacks(19)
0:29.928 void_bolt Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 44.4/100: 44% insanity bloodlust, voidform(21), insanity_drain_stacks(19)
0:30.736 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.0/100: 46% insanity bloodlust, voidform(22), insanity_drain_stacks(20)
0:31.540 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 43.1/100: 43% insanity bloodlust, voidform(23), insanity_drain_stacks(21)
0:32.804 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.3/100: 46% insanity bloodlust, voidform(24), insanity_drain_stacks(22), mind_sear_on_hit_reset
0:33.589 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.6/100: 47% insanity bloodlust, voidform(25), insanity_drain_stacks(23), mind_sear_on_hit_reset
0:34.910 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.6/100: 43% insanity bloodlust, twist_of_fate, voidform(26), insanity_drain_stacks(24), mind_sear_on_hit_reset
0:35.916 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.7/100: 41% insanity bloodlust, twist_of_fate, voidform(27), insanity_drain_stacks(25), mind_sear_on_hit_reset
0:36.688 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.9/100: 37% insanity bloodlust, twist_of_fate, voidform(28), insanity_drain_stacks(26), mind_sear_on_hit_reset
0:38.036 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 29.6/100: 30% insanity bloodlust, twist_of_fate, voidform(29), insanity_drain_stacks(27), mind_sear_on_hit_reset
0:38.792 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 33.1/100: 33% insanity bloodlust, twist_of_fate, voidform(30), insanity_drain_stacks(28), mind_sear_on_hit_reset
0:40.187 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.1/100: 27% insanity bloodlust, twist_of_fate, voidform(32), insanity_drain_stacks(30), mind_sear_on_hit_reset
0:41.044 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.6/100: 28% insanity twist_of_fate, voidform(32), insanity_drain_stacks(30), mind_sear_on_hit_reset
0:42.012 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 23.6/100: 24% insanity twist_of_fate, voidform(33), insanity_drain_stacks(31), mind_sear_on_hit_reset
0:42.970 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 8.8/100: 9% insanity twist_of_fate, voidform(34), insanity_drain_stacks(32), mind_sear_on_hit_reset
0:43.917 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 1.1/100: 1% insanity twist_of_fate, voidform(35), insanity_drain_stacks(33)
0:45.131 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity raid_movement, twist_of_fate, lingering_insanity(35)
0:46.077 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/100: 3% insanity twist_of_fate, lingering_insanity(35)
0:47.022 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.0/100: 15% insanity twist_of_fate, lingering_insanity(35)
0:50.310 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.0/100: 27% insanity raid_movement, lingering_insanity(35)
0:51.255 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.0/100: 30% insanity raid_movement, lingering_insanity(35)
0:52.201 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 33.0/100: 33% insanity raid_movement, lingering_insanity(35)
0:53.147 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.0/100: 36% insanity raid_movement, lingering_insanity(35)
0:54.091 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.0/100: 39% insanity lingering_insanity(35)
0:55.037 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 51.0/100: 51% insanity lingering_insanity(35)
0:55.982 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 55.0/100: 55% insanity lingering_insanity(35)
0:56.928 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 59.0/100: 59% insanity lingering_insanity(35)
0:57.874 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 67.0/100: 67% insanity lingering_insanity(35)
0:58.820 shadow_word_pain Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 71.0/100: 71% insanity lingering_insanity(35)
0:59.767 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity lingering_insanity(35)
1:00.004 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity raid_movement, lingering_insanity(35)
1:00.949 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity raid_movement, lingering_insanity(35)
1:00.949 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity raid_movement, voidform, insanity_drain_stacks
1:02.208 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.7/100: 70% insanity voidform(2), insanity_drain_stacks(2)
1:03.459 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.9/100: 78% insanity voidform(3), insanity_drain_stacks(3)
1:04.690 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.9/100: 94% insanity voidform(4), insanity_drain_stacks(4)
1:07.098 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.6/100: 96% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7), mind_sear_on_hit_reset
1:08.286 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.6/100: 92% insanity twist_of_fate, voidform(8), insanity_drain_stacks(8), mind_sear_on_hit_reset
1:09.467 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.7/100: 97% insanity twist_of_fate, voidform(9), insanity_drain_stacks(9), mind_sear_on_hit_reset
1:13.685 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.4/100: 97% insanity twist_of_fate, voidform(13), insanity_drain_stacks(9)
1:14.805 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.5/100: 92% insanity twist_of_fate, voidform(14), insanity_drain_stacks(10)
1:15.925 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.2/100: 92% insanity twist_of_fate, voidform(15), insanity_drain_stacks(11)
1:17.207 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.7/100: 78% insanity voidform(17), insanity_drain_stacks(13)
1:18.295 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.0/100: 78% insanity voidform(18), insanity_drain_stacks(14)
1:20.278 void_bolt Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 52.6/100: 53% insanity raid_movement, voidform(20), insanity_drain_stacks(16)
1:21.486 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.9/100: 49% insanity raid_movement, voidform(21), insanity_drain_stacks(17)
1:22.534 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.0/100: 34% insanity raid_movement, voidform(22), insanity_drain_stacks(18)
1:23.573 void_bolt Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 22.5/100: 23% insanity voidform(23), insanity_drain_stacks(19)
1:24.604 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 19.6/100: 20% insanity voidform(24), insanity_drain_stacks(20)
1:25.633 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 12.9/100: 13% insanity voidform(25), insanity_drain_stacks(21)
1:26.654 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 4.0/100: 4% insanity lingering_insanity(26)
1:27.666 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(26)
1:28.678 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity lingering_insanity(26)
1:29.688 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity lingering_insanity(26)
1:30.700 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.0/100: 40% insanity lingering_insanity(26)
1:32.304 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.0/100: 58% insanity raid_movement, lingering_insanity(26), mind_sear_on_hit_reset
1:33.317 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.0/100: 61% insanity lingering_insanity(26), mind_sear_on_hit_reset
1:34.994 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.0/100: 79% insanity twist_of_fate, lingering_insanity(26), mind_sear_on_hit_reset
1:34.994 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.0/100: 79% insanity twist_of_fate, voidform, insanity_drain_stacks, mind_sear_on_hit_reset
1:37.170 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.4/100: 85% insanity twist_of_fate, voidform(3), insanity_drain_stacks(3), mind_sear_on_hit_reset
1:38.409 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.9/100: 85% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4), mind_sear_on_hit_reset
1:39.629 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.4/100: 91% insanity twist_of_fate, voidform(5), insanity_drain_stacks(5), mind_sear_on_hit_reset
1:42.015 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.9/100: 67% insanity twist_of_fate, voidform(8), insanity_drain_stacks(8), mind_sear_on_hit_reset
1:43.193 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.9/100: 77% insanity twist_of_fate, voidform(9), insanity_drain_stacks(9), mind_sear_on_hit_reset
1:44.365 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.3/100: 73% insanity twist_of_fate, voidform(10), insanity_drain_stacks(10), mind_sear_on_hit_reset
1:45.524 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.8/100: 62% insanity twist_of_fate, voidform(11), insanity_drain_stacks(11)
1:46.666 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.7/100: 66% insanity twist_of_fate, voidform(12), insanity_drain_stacks(12)
1:48.279 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.0/100: 46% insanity raid_movement, voidform(14), insanity_drain_stacks(14)
1:49.393 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.1/100: 36% insanity voidform(15), insanity_drain_stacks(15)
1:50.498 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.7/100: 38% insanity raid_movement, voidform(16), insanity_drain_stacks(16)
1:51.590 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 23.3/100: 23% insanity raid_movement, voidform(17), insanity_drain_stacks(17)
1:52.676 void_bolt Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 11.6/100: 12% insanity raid_movement, voidform(18), insanity_drain_stacks(18)
1:53.751 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 8.1/100: 8% insanity voidform(19), insanity_drain_stacks(19)
1:54.823 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(20)
1:55.887 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity lingering_insanity(20)
1:56.949 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity lingering_insanity(20)
1:58.013 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity lingering_insanity(20)
1:59.077 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 28.0/100: 28% insanity lingering_insanity(20)
2:00.141 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity lingering_insanity(20)
2:01.203 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.0/100: 36% insanity lingering_insanity(20)
2:02.267 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.0/100: 56% insanity lingering_insanity(20)
2:04.001 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.0/100: 91% insanity raid_movement, twist_of_fate, lingering_insanity(20), mind_sear_on_hit_reset
2:04.001 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.0/100: 91% insanity raid_movement, twist_of_fate, voidform, insanity_drain_stacks, mind_sear_on_hit_reset
2:05.261 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.7/100: 87% insanity twist_of_fate, voidform(2), insanity_drain_stacks(2), mind_sear_on_hit_reset
2:07.172 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.5/100: 98% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4), mind_sear_on_hit_reset
2:08.394 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.6/100: 92% insanity twist_of_fate, voidform(5), insanity_drain_stacks(5), mind_sear_on_hit_reset
2:10.228 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.5/100: 86% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7), mind_sear_on_hit_reset
2:14.490 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.0/100: 97% insanity twist_of_fate, voidform(11), insanity_drain_stacks(7)
2:15.632 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.2/100: 86% insanity twist_of_fate, voidform(12), insanity_drain_stacks(8)
2:16.771 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.6/100: 88% insanity twist_of_fate, voidform(13), insanity_drain_stacks(9)
2:17.901 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.6/100: 77% insanity twist_of_fate, voidform(14), insanity_drain_stacks(10)
2:19.010 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.3/100: 77% insanity twist_of_fate, voidform(16), insanity_drain_stacks(12)
2:20.503 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.7/100: 62% insanity raid_movement, voidform(17), insanity_drain_stacks(13)
2:21.589 void_bolt Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 49.0/100: 49% insanity voidform(18), insanity_drain_stacks(14)
2:22.664 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.8/100: 52% insanity voidform(19), insanity_drain_stacks(15)
2:23.737 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 47.0/100: 47% insanity voidform(20), insanity_drain_stacks(16)
2:24.799 void_bolt Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 33.4/100: 33% insanity voidform(21), insanity_drain_stacks(17)
2:25.845 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 35.5/100: 36% insanity voidform(22), insanity_drain_stacks(18)
2:26.891 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 20.8/100: 21% insanity voidform(23), insanity_drain_stacks(19)
2:27.928 void_bolt Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 5.9/100: 6% insanity voidform(24), insanity_drain_stacks(20)
2:28.951 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.9/100: 3% insanity voidform(25), insanity_drain_stacks(21)
2:29.972 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity lingering_insanity(26)
2:30.986 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity lingering_insanity(26)
2:35.357 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.0/100: 91% insanity twist_of_fate, lingering_insanity(26), mind_sear_on_hit_reset
2:36.369 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 98.0/100: 98% insanity raid_movement, twist_of_fate, lingering_insanity(26), mind_sear_on_hit_reset
2:36.369 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 98.0/100: 98% insanity raid_movement, twist_of_fate, voidform, insanity_drain_stacks, mind_sear_on_hit_reset
2:37.629 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.7/100: 89% insanity twist_of_fate, voidform(2), insanity_drain_stacks(2), mind_sear_on_hit_reset
2:38.879 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.9/100: 89% insanity twist_of_fate, voidform(3), insanity_drain_stacks(3)
2:40.109 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4)
2:42.825 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.5/100: 66% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7)
2:44.011 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.7/100: 68% insanity twist_of_fate, voidform(8), insanity_drain_stacks(8)
2:45.192 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.5/100: 72% insanity twist_of_fate, voidform(9), insanity_drain_stacks(9)
2:46.362 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.5/100: 62% insanity twist_of_fate, voidform(10), insanity_drain_stacks(10)
2:47.507 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.4/100: 61% insanity twist_of_fate, voidform(12), insanity_drain_stacks(12)
2:50.079 void_bolt Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 39.3/100: 39% insanity raid_movement, voidform(14), insanity_drain_stacks(14)
2:51.190 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.9/100: 38% insanity raid_movement, voidform(15), insanity_drain_stacks(15)
2:52.290 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 23.3/100: 23% insanity raid_movement, voidform(16), insanity_drain_stacks(16)
2:53.380 void_bolt Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 11.7/100: 12% insanity voidform(18), insanity_drain_stacks(18)
2:54.462 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 13.7/100: 14% insanity voidform(19), insanity_drain_stacks(19)
2:55.534 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(19)
2:56.605 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity lingering_insanity(19)
2:57.679 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity lingering_insanity(19)
2:58.753 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 28.0/100: 28% insanity lingering_insanity(19)
2:59.824 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity lingering_insanity(19)
3:00.898 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.0/100: 40% insanity lingering_insanity(19)
3:01.970 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.0/100: 48% insanity lingering_insanity(19)
3:03.043 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.0/100: 64% insanity lingering_insanity(19)
3:04.704 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity twist_of_fate, lingering_insanity(19), mind_sear_on_hit_reset
3:04.704 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity twist_of_fate, voidform, insanity_drain_stacks, mind_sear_on_hit_reset
3:07.207 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.7/100: 97% insanity twist_of_fate, voidform(3), insanity_drain_stacks(3), mind_sear_on_hit_reset
3:08.440 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.0/100: 96% insanity raid_movement, twist_of_fate, voidform(4), insanity_drain_stacks(4), mind_sear_on_hit_reset
3:09.656 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.5/100: 90% insanity twist_of_fate, voidform(5), insanity_drain_stacks(5), mind_sear_on_hit_reset
3:11.471 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.9/100: 84% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7), mind_sear_on_hit_reset
3:12.655 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.5/100: 90% insanity twist_of_fate, voidform(8), insanity_drain_stacks(8), mind_sear_on_hit_reset
3:16.938 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.7/100: 97% insanity voidform(13), insanity_drain_stacks(9)
3:18.063 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.0/100: 85% insanity voidform(14), insanity_drain_stacks(10)
3:18.211 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.1/100: 83% insanity berserking, voidform(14), insanity_drain_stacks(10)
3:19.184 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.2/100: 82% insanity berserking, voidform(15), insanity_drain_stacks(11)
3:20.448 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 66.7/100: 67% insanity berserking, raid_movement, voidform(16), insanity_drain_stacks(12)
3:21.398 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.7/100: 69% insanity berserking, raid_movement, voidform(17), insanity_drain_stacks(13)
3:22.339 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.5/100: 57% insanity berserking, raid_movement, voidform(18), insanity_drain_stacks(14)
3:23.274 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 45.6/100: 46% insanity berserking, raid_movement, voidform(19), insanity_drain_stacks(15)
3:24.200 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 47.2/100: 47% insanity berserking, raid_movement, voidform(20), insanity_drain_stacks(16)
3:25.122 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.6/100: 35% insanity berserking, raid_movement, voidform(21), insanity_drain_stacks(17)
3:26.036 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 26.3/100: 26% insanity berserking, voidform(22), insanity_drain_stacks(18)
3:26.944 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.7/100: 35% insanity berserking, voidform(23), insanity_drain_stacks(19)
3:27.847 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 30.5/100: 31% insanity berserking, voidform(24), insanity_drain_stacks(20)
3:28.822 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 16.4/100: 16% insanity voidform(25), insanity_drain_stacks(21)
3:29.843 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 17.4/100: 17% insanity voidform(26), insanity_drain_stacks(22)
3:30.855 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/100: 4% insanity lingering_insanity(27)
3:32.484 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.0/100: 35% insanity lingering_insanity(27), mind_sear_on_hit_reset
3:33.489 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.0/100: 51% insanity lingering_insanity(27), mind_sear_on_hit_reset
3:35.746 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.0/100: 82% insanity twist_of_fate, lingering_insanity(27), mind_sear_on_hit_reset
3:35.746 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.0/100: 82% insanity twist_of_fate, voidform, insanity_drain_stacks, mind_sear_on_hit_reset
3:38.248 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.9/100: 77% insanity twist_of_fate, voidform(3), insanity_drain_stacks(3), mind_sear_on_hit_reset
3:39.479 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.9/100: 85% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4), mind_sear_on_hit_reset
3:41.042 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.1/100: 68% insanity raid_movement, twist_of_fate, voidform(6), insanity_drain_stacks(6), mind_sear_on_hit_reset
3:42.240 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.4/100: 57% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7), mind_sear_on_hit_reset
3:43.424 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.1/100: 63% insanity twist_of_fate, voidform(8), insanity_drain_stacks(8), mind_sear_on_hit_reset
3:44.606 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.8/100: 60% insanity twist_of_fate, voidform(9), insanity_drain_stacks(9)
3:45.775 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.8/100: 53% insanity twist_of_fate, voidform(11), insanity_drain_stacks(11)
3:46.920 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.7/100: 53% insanity twist_of_fate, voidform(12), insanity_drain_stacks(12)
3:49.421 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 28.0/100: 28% insanity voidform(14), insanity_drain_stacks(14)
3:50.533 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 26.7/100: 27% insanity raid_movement, voidform(15), insanity_drain_stacks(15)
3:51.634 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.1/100: 12% insanity raid_movement, voidform(16), insanity_drain_stacks(16)
3:52.726 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity raid_movement, lingering_insanity(17)
3:53.817 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 7.0/100: 7% insanity lingering_insanity(17)
3:54.905 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 19.0/100: 19% insanity lingering_insanity(17)
3:55.997 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 23.0/100: 23% insanity lingering_insanity(17)
3:57.088 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.0/100: 27% insanity raid_movement, lingering_insanity(17)
3:58.179 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 30.0/100: 30% insanity lingering_insanity(17)
3:59.270 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 34.0/100: 34% insanity lingering_insanity(17)
4:00.361 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.0/100: 38% insanity lingering_insanity(17)
4:01.942 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.0/100: 69% insanity lingering_insanity(17), mind_sear_on_hit_reset
4:03.032 shadow_word_pain Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 73.0/100: 73% insanity lingering_insanity(17), mind_sear_on_hit_reset
4:04.122 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity twist_of_fate, lingering_insanity(17), mind_sear_on_hit_reset
4:04.122 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity twist_of_fate, voidform, insanity_drain_stacks, mind_sear_on_hit_reset
4:05.384 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.7/100: 89% insanity twist_of_fate, voidform(2), insanity_drain_stacks(2)
4:07.141 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 99.0/100: 99% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4), mind_sear_on_hit_reset
4:08.364 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.8/100: 92% insanity twist_of_fate, voidform(5), insanity_drain_stacks(5), mind_sear_on_hit_reset
4:10.176 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.3/100: 97% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7), mind_sear_on_hit_reset
4:11.452 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity twist_of_fate, voidform(8), insanity_drain_stacks(8), mind_sear_on_hit_reset
4:12.627 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.2/100: 86% insanity raid_movement, twist_of_fate, voidform(9), insanity_drain_stacks(9), mind_sear_on_hit_reset
4:13.793 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.3/100: 78% insanity twist_of_fate, voidform(10), insanity_drain_stacks(10)
4:18.033 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.0/100: 95% insanity twist_of_fate, voidform(14), insanity_drain_stacks(10)
4:19.142 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.6/100: 85% insanity twist_of_fate, voidform(16), insanity_drain_stacks(12)
4:20.238 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.1/100: 69% insanity raid_movement, voidform(17), insanity_drain_stacks(13)
4:21.326 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 55.6/100: 56% insanity raid_movement, voidform(18), insanity_drain_stacks(14)
4:22.404 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.5/100: 56% insanity raid_movement, voidform(19), insanity_drain_stacks(15)
4:23.475 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.9/100: 41% insanity raid_movement, voidform(20), insanity_drain_stacks(16)
4:24.533 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 53.7/100: 54% insanity twist_of_fate, voidform(21), insanity_drain_stacks(17)
4:25.583 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.9/100: 56% insanity twist_of_fate, voidform(22), insanity_drain_stacks(18)
4:26.630 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 53.5/100: 53% insanity twist_of_fate, voidform(23), insanity_drain_stacks(19)
4:27.667 void_bolt Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 39.5/100: 39% insanity twist_of_fate, voidform(24), insanity_drain_stacks(20)
4:28.694 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.0/100: 40% insanity raid_movement, twist_of_fate, voidform(25), insanity_drain_stacks(21)
4:29.709 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 23.9/100: 24% insanity twist_of_fate, voidform(26), insanity_drain_stacks(22)
4:30.721 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 8.3/100: 8% insanity twist_of_fate, voidform(27), insanity_drain_stacks(23)
4:31.720 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 8.3/100: 8% insanity twist_of_fate, voidform(28), insanity_drain_stacks(24)
4:32.713 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 17.7/100: 18% insanity twist_of_fate, voidform(29), insanity_drain_stacks(25)
4:33.697 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 26.8/100: 27% insanity twist_of_fate, voidform(30), insanity_drain_stacks(26)
4:34.673 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 25.2/100: 25% insanity twist_of_fate, voidform(31), insanity_drain_stacks(27)
4:35.649 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.3/100: 16% insanity twist_of_fate, voidform(32), insanity_drain_stacks(28)
4:37.166 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 13.2/100: 13% insanity twist_of_fate, voidform(34), insanity_drain_stacks(30), mind_sear_on_hit_reset
4:38.117 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.4/100: 15% insanity twist_of_fate, voidform(34), insanity_drain_stacks(30), mind_sear_on_hit_reset
4:39.577 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.0/100: 18% insanity twist_of_fate, lingering_insanity(35), mind_sear_on_hit_reset
4:40.521 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.0/100: 34% insanity twist_of_fate, lingering_insanity(35), mind_sear_on_hit_reset
4:44.999 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.0/100: 52% insanity raid_movement, twist_of_fate, lingering_insanity(35)
4:45.944 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.0/100: 59% insanity twist_of_fate, lingering_insanity(35)
4:47.112 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity twist_of_fate, lingering_insanity(35)
4:47.112 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity twist_of_fate, voidform, insanity_drain_stacks
4:49.911 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.4/100: 61% insanity twist_of_fate, voidform(3), insanity_drain_stacks(3)
4:51.139 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.9/100: 69% insanity raid_movement, twist_of_fate, voidform(5), insanity_drain_stacks(5)
4:52.352 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.7/100: 86% insanity raid_movement, twist_of_fate, voidform(6), insanity_drain_stacks(6)
4:53.551 void_bolt Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 75.1/100: 75% insanity raid_movement, twist_of_fate, voidform(7), insanity_drain_stacks(7)
4:54.737 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.7/100: 77% insanity twist_of_fate, voidform(8), insanity_drain_stacks(8)
4:55.918 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 77.4/100: 77% insanity twist_of_fate, voidform(9), insanity_drain_stacks(9)
4:57.087 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 66.5/100: 66% insanity twist_of_fate, voidform(10), insanity_drain_stacks(10)
4:58.234 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 66.3/100: 66% insanity twist_of_fate, voidform(12), insanity_drain_stacks(12)
4:59.373 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 53.9/100: 54% insanity twist_of_fate, voidform(13), insanity_drain_stacks(13)
5:00.498 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.4/100: 37% insanity raid_movement, twist_of_fate, voidform(14), insanity_drain_stacks(14)
5:01.613 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.6/100: 40% insanity twist_of_fate, voidform(15), insanity_drain_stacks(15)
5:02.723 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.0/100: 34% insanity twist_of_fate, voidform(16), insanity_drain_stacks(16)
5:03.816 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.7/100: 16% insanity twist_of_fate, voidform(17), insanity_drain_stacks(17)
5:04.898 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 21.8/100: 22% insanity twist_of_fate, voidform(18), insanity_drain_stacks(18)
5:05.971 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.2/100: 44% insanity twist_of_fate, voidform(19), insanity_drain_stacks(19)
5:07.618 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.0/100: 57% insanity twist_of_fate, voidform(21), insanity_drain_stacks(21), mind_sear_on_hit_reset
5:08.667 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.0/100: 61% insanity twist_of_fate, voidform(22), insanity_drain_stacks(22), mind_sear_on_hit_reset
5:09.714 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.4/100: 56% insanity twist_of_fate, voidform(23), insanity_drain_stacks(23), mind_sear_on_hit_reset
5:11.281 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.2/100: 40% insanity twist_of_fate, voidform(25), insanity_drain_stacks(25), mind_sear_on_hit_reset
5:12.299 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.2/100: 35% insanity twist_of_fate, voidform(26), insanity_drain_stacks(26), mind_sear_on_hit_reset
5:14.609 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 9.4/100: 9% insanity twist_of_fate, voidform(28), insanity_drain_stacks(28), mind_sear_on_hit_reset
5:15.602 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 10.9/100: 11% insanity twist_of_fate, voidform(29), insanity_drain_stacks(29)
5:16.780 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.5/100: 5% insanity raid_movement, twist_of_fate, voidform(30), insanity_drain_stacks(30)
5:17.758 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity twist_of_fate, voidform(31), insanity_drain_stacks(31)
5:18.726 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 8.0/100: 8% insanity twist_of_fate, voidform(32), insanity_drain_stacks(32)
5:19.689 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 14.6/100: 15% insanity twist_of_fate, voidform(33), insanity_drain_stacks(33)
5:20.649 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity twist_of_fate, lingering_insanity(34)
5:27.050 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.0/100: 50% insanity twist_of_fate, lingering_insanity(34)
5:28.003 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.0/100: 66% insanity twist_of_fate, lingering_insanity(34)
5:30.651 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity twist_of_fate, lingering_insanity(34)
5:30.651 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity twist_of_fate, voidform, insanity_drain_stacks
5:32.336 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.1/100: 69% insanity raid_movement, twist_of_fate, voidform(2), insanity_drain_stacks(2)
5:33.576 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.9/100: 60% insanity twist_of_fate, voidform(3), insanity_drain_stacks(3)
5:34.801 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.8/100: 64% insanity twist_of_fate, voidform(5), insanity_drain_stacks(5)
5:36.017 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.0/100: 62% insanity twist_of_fate, voidform(6), insanity_drain_stacks(6)
5:37.213 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.3/100: 86% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7)
5:38.399 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.2/100: 86% insanity twist_of_fate, voidform(8), insanity_drain_stacks(8)
5:40.936 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.0/100: 65% insanity twist_of_fate, voidform(11), insanity_drain_stacks(11)
5:42.080 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.9/100: 65% insanity twist_of_fate, voidform(12), insanity_drain_stacks(12)
5:43.218 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.2/100: 60% insanity twist_of_fate, voidform(13), insanity_drain_stacks(13)
5:44.348 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.7/100: 52% insanity twist_of_fate, voidform(14), insanity_drain_stacks(14)
5:45.460 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 49.6/100: 50% insanity twist_of_fate, voidform(15), insanity_drain_stacks(15)
5:46.562 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.0/100: 66% insanity twist_of_fate, voidform(16), insanity_drain_stacks(16)
5:47.660 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.3/100: 51% insanity twist_of_fate, voidform(18), insanity_drain_stacks(18)
5:48.740 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 49.4/100: 49% insanity raid_movement, twist_of_fate, voidform(19), insanity_drain_stacks(19)
5:49.812 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.6/100: 33% insanity twist_of_fate, voidform(20), insanity_drain_stacks(20)
5:50.876 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 25.4/100: 25% insanity twist_of_fate, voidform(21), insanity_drain_stacks(21)
5:51.927 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 21.5/100: 21% insanity twist_of_fate, voidform(22), insanity_drain_stacks(22)
5:54.326 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/100: 4% insanity twist_of_fate, lingering_insanity(23)
5:56.092 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 18.0/100: 18% insanity twist_of_fate, lingering_insanity(23)
5:57.128 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.0/100: 48% insanity twist_of_fate, lingering_insanity(23)
5:58.167 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.0/100: 60% insanity twist_of_fate, lingering_insanity(23)
6:01.486 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity twist_of_fate, lingering_insanity(23)
6:01.486 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity twist_of_fate, voidform, insanity_drain_stacks
6:04.204 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.9/100: 61% insanity raid_movement, twist_of_fate, voidform(3), insanity_drain_stacks(3)
6:05.433 potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.9/100: 49% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4)
6:05.433 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.9/100: 49% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4), potion_of_deadly_grace
6:06.646 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.2/100: 55% insanity twist_of_fate, voidform(6), insanity_drain_stacks(6), potion_of_deadly_grace
6:07.849 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.6/100: 62% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7), potion_of_deadly_grace
6:09.035 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.9/100: 82% insanity twist_of_fate, voidform(8), insanity_drain_stacks(8), potion_of_deadly_grace
6:10.208 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity twist_of_fate, voidform(9), insanity_drain_stacks(9), potion_of_deadly_grace
6:12.724 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.3/100: 72% insanity twist_of_fate, voidform(12), insanity_drain_stacks(12), potion_of_deadly_grace
6:13.860 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.8/100: 76% insanity twist_of_fate, voidform(13), insanity_drain_stacks(13), potion_of_deadly_grace
6:14.990 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.5/100: 75% insanity twist_of_fate, voidform(14), insanity_drain_stacks(14), potion_of_deadly_grace
6:16.107 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.4/100: 69% insanity twist_of_fate, voidform(15), insanity_drain_stacks(15), potion_of_deadly_grace
6:17.208 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.8/100: 72% insanity twist_of_fate, voidform(16), insanity_drain_stacks(16), potion_of_deadly_grace
6:20.249 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.8/100: 76% insanity raid_movement, twist_of_fate, voidform(19), insanity_drain_stacks(16), potion_of_deadly_grace
6:20.249 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.8/100: 76% insanity berserking, raid_movement, twist_of_fate, voidform(19), insanity_drain_stacks(16), potion_of_deadly_grace
6:21.176 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.7/100: 77% insanity berserking, twist_of_fate, voidform(20), insanity_drain_stacks(17), potion_of_deadly_grace
6:22.103 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.5/100: 77% insanity berserking, twist_of_fate, voidform(21), insanity_drain_stacks(18), potion_of_deadly_grace
6:23.014 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.1/100: 84% insanity berserking, twist_of_fate, voidform(22), insanity_drain_stacks(19), potion_of_deadly_grace
6:23.920 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.8/100: 84% insanity berserking, twist_of_fate, voidform(23), insanity_drain_stacks(20), potion_of_deadly_grace
6:25.920 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.3/100: 62% insanity berserking, twist_of_fate, voidform(25), insanity_drain_stacks(22), potion_of_deadly_grace
6:26.805 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.9/100: 61% insanity berserking, twist_of_fate, voidform(26), insanity_drain_stacks(23), potion_of_deadly_grace
6:27.687 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.9/100: 55% insanity berserking, twist_of_fate, voidform(27), insanity_drain_stacks(24), potion_of_deadly_grace
6:28.561 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 49.8/100: 50% insanity berserking, twist_of_fate, voidform(28), insanity_drain_stacks(25), potion_of_deadly_grace
6:29.429 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.9/100: 52% insanity berserking, twist_of_fate, voidform(28), insanity_drain_stacks(25), potion_of_deadly_grace
6:31.393 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 17.0/100: 17% insanity twist_of_fate, voidform(30), insanity_drain_stacks(27)
6:32.367 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.1/100: 16% insanity twist_of_fate, voidform(31), insanity_drain_stacks(28)
6:33.334 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.3/100: 24% insanity twist_of_fate, voidform(32), insanity_drain_stacks(29)
6:34.302 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 13.3/100: 13% insanity twist_of_fate, voidform(33), insanity_drain_stacks(30)
6:35.256 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 10.7/100: 11% insanity twist_of_fate, voidform(34), insanity_drain_stacks(31)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6255 5930 0
Agility 7831 7506 0
Stamina 32570 32570 20493
Intellect 30857 29150 20439 (729)
Spirit 1 1 0
Health 1954200 1954200 0
Mana 1100000 1100000 0
Insanity 100 100 0
Spell Power 30857 29150 0
Crit 32.68% 32.68% 9689
Haste 18.00% 16.84% 5474
Damage / Heal Versatility 2.76% 2.76% 1102
ManaReg per Second 8800 8800 0
Mastery 53.08% 53.08% 4632
Armor 1647 1647 1647
Run Speed 7 0 333

Gear

Source Slot Average Item Level: 858.00
Local Head Hood of Darkened Visions
ilevel: 860, stats: { 219 Armor, +2135 Sta, +1424 Int, +822 Crit, +532 Mastery }
Local Neck Blackened Portalstone Necklace
ilevel: 865, stats: { +1258 Sta, +1276 Crit, +665 Haste, +333 RunSpeed }
Local Shoulders Roggthread Mantle
ilevel: 845, stats: { 192 Armor, +929 Int, +1393 Sta, +666 Haste, +295 Vers }
Local Chest Maddening Robe of Secrets
ilevel: 850, stats: { 260 Armor, +1945 Sta, +1297 Int, +876 Mastery, +428 Crit }
Local Waist Bonespeaker Cinch
ilevel: 830, stats: { 136 Armor, +807 Int, +1211 Sta, +551 Crit, +356 Mastery }
Local Legs Legwraps of Rampant Turmoil
ilevel: 845, stats: { 224 Armor, +1238 Int, +1857 Sta, +777 Crit, +503 Haste }
Local Feet Norgannon's Foresight
ilevel: 895, stats: { 210 Armor, +2219 Sta, +1479 Int, +662 Haste, +496 Mastery }
Local Wrists Bracers of the High Priest
ilevel: 840, stats: { 110 Armor, +997 Sta, +665 Int, +475 Crit, +232 Haste }
Local Hands Handwraps of Delusional Power
ilevel: 855, stats: { 166 Armor, +1529 Sta, +1019 Int, +648 Haste, +349 Crit }
Local Finger1 Twice-Warped Azsharan Signet
ilevel: 850, stats: { +1094 Sta, +1258 Crit, +577 Haste }
Local Finger2 Cursed Warden's Keepsake
ilevel: 865, stats: { +1258 Sta, +1109 Crit, +832 Mastery }, enchant: { +150 Haste }
Local Trinket1 Unstable Horrorslime
ilevel: 860, stats: { +968 Crit }
Local Trinket2 Unstable Arcanocrystal
ilevel: 860, stats: { +807 Vers, +807 Mastery, +807 Crit, +807 Haste }
Local Back Gossamer-Spun Greatcloak
ilevel: 850, stats: { 130 Armor, +729 StrAgiInt, +1094 Sta, +430 Mastery, +304 Crit }
Local Main Hand Xal'atath, Blade of the Black Empire
ilevel: 878, weapon: { 1480 - 2751, 1.8 }, stats: { +722 Int, +1082 Sta, +315 Crit, +303 Mastery, +9183 Int }, relics: { +45 ilevels, +43 ilevels, +40 ilevels }
Local Off Hand Secrets of the Void
ilevel: 878, stats: { +947 Int, +1421 Sta, +564 Haste, +250 Crit }

Talents

Level
15 Twist of Fate (Shadow Priest) Fortress of the Mind (Shadow Priest) Shadow Word: Void (Shadow Priest)
30 Mania (Shadow Priest) Body and Soul Masochism
45 Mind Bomb (Shadow Priest) Psychic Voice Dominant Mind
60 Void Lord (Shadow Priest) Reaper of Souls (Shadow Priest) Void Ray (Shadow Priest)
75 San'layn (Shadow Priest) Auspicious Spirits (Shadow Priest) Shadowy Insight (Shadow Priest)
90 Power Infusion (Shadow Priest) Shadow Crash (Shadow Priest) Mindbender (Shadow Priest)
100 Legacy of the Void (Shadow Priest) Mind Spike (Shadow Priest) Surrender to Madness (Shadow Priest)

Profile

priest="Raji"
origin="https://us.api.battle.net/wow/character/thrall/Raji/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/153/136128921-avatar.jpg"
level=110
race=troll
role=spell
position=back
professions=tailoring=755/enchanting=714
talents=1212231
artifact=47:0:0:0:0:764:1:765:1:766:1:767:3:768:1:771:3:773:3:774:1:775:3:777:3:778:3:1347:1
spec=shadow

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/mind_blast

# Executed every time the actor is available.
actions=potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
actions+=/variable,op=set,name=actors_fight_time_mod,value=0
actions+=/variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
actions+=/variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
actions+=/variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
actions+=/variable,op=min,name=s2mcheck,value=180
actions+=/call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
actions+=/call_action_list,name=vf,if=buff.voidform.up
actions+=/call_action_list,name=main

actions.main=surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
actions.main+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
actions.main+=/shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
actions.main+=/vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
actions.main+=/void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
actions.main+=/shadow_crash,if=talent.shadow_crash.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
actions.main+=/shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
actions.main+=/shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
actions.main+=/mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
actions.main+=/mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.main+=/shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
actions.main+=/mind_sear,if=active_enemies>=3,interrupt=1,chain=1
actions.main+=/mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
actions.main+=/mind_spike,if=talent.mind_spike.enabled
actions.main+=/shadow_word_pain

actions.s2m=shadow_crash,if=talent.shadow_crash.enabled
actions.s2m+=/mindbender,if=talent.mindbender.enabled
actions.s2m+=/dispersion,if=!buff.power_infusion.up&!buff.berserking.up&!buff.bloodlust.up
actions.s2m+=/power_infusion,if=buff.insanity_drain_stacks.stack>=85
actions.s2m+=/berserking,if=buff.voidform.stack>=90
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt
actions.s2m+=/void_torrent
actions.s2m+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.s2m+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+90)<100
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.s2m+=/mind_blast
actions.s2m+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.s2m+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.s2m+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.s2m+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+75)<100
actions.s2m+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.s2m+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.s2m+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.s2m+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.s2m+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.s2m+=/mind_spike,if=talent.mind_spike.enabled

actions.vf=surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
actions.vf+=/shadow_crash,if=talent.shadow_crash.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
actions.vf+=/berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
actions.vf+=/berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt
actions.vf+=/void_torrent,if=!talent.surrender_to_madness.enabled
actions.vf+=/void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
actions.vf+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
actions.vf+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.vf+=/mind_blast
actions.vf+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.vf+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.vf+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.vf+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
actions.vf+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.vf+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.vf+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.vf+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.vf+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.vf+=/mind_spike,if=talent.mind_spike.enabled
actions.vf+=/shadow_word_pain

head=hood_of_darkened_visions,id=139189,bonus_id=1807/1808/1482/3336
neck=blackened_portalstone_necklace,id=139332,bonus_id=1807/42/1487/3337
shoulders=roggthread_mantle,id=134177,bonus_id=1727/1507/3336
back=gossamerspun_greatcloak,id=138221,bonus_id=1807/1472
chest=maddening_robe_of_secrets,id=139193,bonus_id=1807/1472
wrists=bracers_of_the_high_priest,id=139762,bonus_id=3386/3384
hands=handwraps_of_delusional_power,id=138212,bonus_id=1807/1808/1477/3336
waist=bonespeaker_cinch,id=134215,bonus_id=3397/1492/1675
legs=legwraps_of_rampant_turmoil,id=137453,bonus_id=1727/1497/3336
feet=norgannons_foresight,id=132455,bonus_id=1811
finger1=twicewarped_azsharan_signet,id=139238,bonus_id=1807/1472
finger2=cursed_wardens_keepsake,id=141546,bonus_id=1477/3336,enchant=150haste
trinket1=unstable_horrorslime,id=138224,bonus_id=1807/1808/1482/3336
trinket2=unstable_arcanocrystal,id=141482,bonus_id=1472
main_hand=xalatath_blade_of_the_black_empire,id=128827,bonus_id=740,gem_id=137347/139257/137377/0,relic_id=1727:1507:3337/1807:1472/1727:1492:1813/0
off_hand=secrets_of_the_void,id=133958

# Gear Summary
# gear_ilvl=857.88
# gear_stamina=20493
# gear_intellect=20439
# gear_crit_rating=9689
# gear_haste_rating=5474
# gear_mastery_rating=4632
# gear_versatility_rating=1102
# gear_speed_rating=333
# gear_armor=1647

Vait

Vait : 386232 dps, 271111 dps to main target

  • Race: Undead
  • Class: Rogue
  • Spec: Outlaw
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
386231.8 386231.8 559.4 / 0.145% 111829.6 / 29.0% 13740.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
28.0 28.0 Energy 13.78% 63.2 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Vait/advanced
Talents
  • 15: Ghostly Strike (Outlaw Rogue)
  • 30: Grappling Hook (Outlaw Rogue)
  • 45: Deeper Stratagem
  • 60: Cheat Death
  • 75: Dirty Tricks (Outlaw Rogue)
  • 90: Alacrity
  • 100: Marked for Death
  • Talent Calculator
Artifact
Professions
  • herbalism: 114
  • skinning: 800
Scale Factors for Vait Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 13.43 9.16 8.09 7.43 5.49
Normalized 1.00 0.68 0.60 0.55 0.41
Scale Deltas 1138 1138 1138 1138 1138
Error 0.71 0.70 0.70 0.69 0.70
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit ~= Haste > Mastery
Pawn string ( Pawn: v1: "Vait": Agility=13.43, CritRating=8.09, HasteRating=7.43, MasteryRating=5.49, Versatility=9.16 )

Scale Factors for other metrics

Scale Factors for Vait Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 13.43 9.16 8.09 7.43 5.49
Normalized 1.00 0.68 0.60 0.55 0.41
Scale Deltas 1138 1138 1138 1138 1138
Error 0.71 0.70 0.70 0.69 0.70
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit ~= Haste > Mastery
Pawn string ( Pawn: v1: "Vait": Agility=13.43, CritRating=8.09, HasteRating=7.43, MasteryRating=5.49, Versatility=9.16 )
Scale Factors for Vait Priority Target Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 9.54 6.43 5.74 5.04 4.34
Normalized 1.00 0.67 0.60 0.53 0.45
Scale Deltas 1138 1138 1138 1138 1138
Error 0.38 0.38 0.38 0.37 0.38
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Haste > Mastery
Pawn string ( Pawn: v1: "Vait": Agility=9.54, CritRating=5.74, HasteRating=5.04, MasteryRating=4.34, Versatility=6.43 )
Scale Factors for Vait Damage Per Second (Effective)
Agi Vers Crit Haste Mastery
Scale Factors 13.43 9.16 8.09 7.43 5.49
Normalized 1.00 0.68 0.60 0.55 0.41
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Haste > Mastery
Pawn string ( Pawn: v1: "Vait": Agility=13.43, CritRating=8.09, HasteRating=7.43, MasteryRating=5.49, Versatility=9.16 )
Scale Factors for Vait Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Vait Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Vait Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Vait Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Vait Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Vait Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Vait Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for VaitTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Vait 386232
Ambush 2630 0.7% 7.0 64.98sec 149727 149074 Direct 7.0 111671 224087 149724 33.9% 0.0%  

Stats details: ambush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.03 7.03 0.00 0.00 1.0045 0.0000 1052011.94 1546557.21 31.98 149073.54 149073.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.65 66.15% 111670.65 103906 114297 111264.07 0 114297 519010 762994 31.89
crit 2.38 33.85% 224086.67 207812 228593 209295.53 0 228593 533002 783564 29.87
 
 

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:
  • description:Ambush the target, causing $sw2 Physical damage. |cFFFFFFFFAwards {$s3=2} combo $lpoint:points;.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.50
 
auto_attack_mh 20242 5.3% 256.2 1.57sec 31686 24838 Direct 256.2 27025 54053 31686 36.2% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 256.20 256.20 0.00 0.00 1.2757 0.0000 8118065.68 11934325.51 31.98 24838.19 24838.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 114.73 44.78% 27024.56 24648 27113 27023.50 26662 27113 3100409 4557895 31.98
crit 92.83 36.23% 54053.33 49296 54225 54053.03 53220 54225 5017656 7376430 31.98
miss 48.65 18.99% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 9393 2.4% 237.6 1.69sec 15856 11451 Direct 237.6 13516 27031 15856 36.3% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 237.63 237.63 0.00 0.00 1.3847 0.0000 3767903.80 5539175.49 31.98 11451.24 11451.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 106.25 44.71% 13515.94 12324 13556 13515.51 13307 13556 1436061 2111145 31.98
crit 86.27 36.30% 27030.87 24648 27113 27031.03 26620 27113 2331843 3428030 31.98
miss 45.11 18.98% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Blade Flurry (_attack) 80950 20.8% 416.3 0.98sec 76813 0 Direct 2081.7 15363 0 15363 0.0% 0.0%  

Stats details: blade_flurry_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 416.35 2081.73 0.00 0.00 0.0000 0.0000 31980994.13 47015090.70 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2081.73 100.00% 15362.51 4313 80008 15371.81 13070 18464 31980994 47015091 31.98
 
 

Action details: blade_flurry_attack

Static Values
  • id:22482
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:22482
  • name:Blade Flurry
  • school:physical
  • tooltip:
  • description:{$@spelldesc13877=While active, your melee attacks also strike all nearby enemies for {$s3=35}% of normal damage$?s56818[ and the application chance of Non-Lethal poisons is increased by {$s2=0}%][], but your Energy regeneration is reduced by {$s1=20}%. Lasts until cancelled.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:39858.29
  • base_dd_max:39858.29
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Ghostly Strike 4020 1.0% 27.0 15.05sec 59671 62192 Direct 27.0 43854 87762 59670 36.0% 0.0%  

Stats details: ghostly_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.01 27.01 129.11 0.00 0.9595 2.9876 1611578.87 2369173.60 31.98 3915.02 62191.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.28 63.98% 43854.17 40640 44704 43843.47 42266 44704 757749 1113964 31.98
crit 9.73 36.02% 87761.61 81280 89408 87746.46 81280 89408 853829 1255210 31.98
 
 

Action details: ghostly_strike

Static Values
  • id:196937
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit>=1+buff.broadsides.up&!buff.curse_of_the_dreadblades.up&(debuff.ghostly_strike.remains<debuff.ghostly_strike.duration*0.3|(cooldown.curse_of_the_dreadblades.remains<3&debuff.ghostly_strike.remains<14))&(combo_points>=3|(variable.rtb_reroll&time>=10))
Spelldata
  • id:196937
  • name:Ghostly Strike
  • school:physical
  • tooltip:Taking {$s5=10}% increased damage from the Rogue's abilities.
  • description:Strikes an enemy with your cursed weapon, dealing $sw2 Physical damage and causing the target to take {$s5=10}% increased damage from your abilities for {$d=15 seconds}. |cFFFFFFFFAwards {$s1=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.76
 
Greed 33260 (49898) 8.6% (12.8%) 34.8 11.34sec 568725 0 Direct 116.3 83171 166359 113426 36.4% 0.0%  

Stats details: greed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.79 116.28 0.00 0.00 0.0000 0.0000 13189666.82 19390059.59 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.99 63.63% 83170.87 80816 88897 83201.90 81694 85896 6153763 9046615 31.98
crit 42.29 36.37% 166359.26 161632 177795 166442.25 162746 173081 7035904 10343445 31.98
 
 

Action details: greed

Static Values
  • id:202822
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202822
  • name:Greed
  • school:physical
  • tooltip:
  • description:{$@spelldesc202820=Run Through occasionally awakens |cFFFFCC99The Dreadblades|r, unleashing a sweeping attack against all nearby enemies for ${$202822sw2 + $202823sw2} Physical damage, and healing you for ${$MHP*.05} per target hit.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.50
 
    Greed (_oh) 16638 4.3% 34.8 11.34sec 189646 0 Direct 116.3 41586 83179 56739 36.4% 0.0%  

Stats details: greed_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.79 116.28 0.00 0.00 0.0000 0.0000 6597570.11 9699053.00 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.92 63.57% 41585.59 40408 44449 41602.03 40833 43395 3073843 4518840 31.98
crit 42.36 36.43% 83178.59 80816 88897 83214.54 81127 86438 3523728 5180213 31.98
 
 

Action details: greed_oh

Static Values
  • id:202823
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202823
  • name:Greed
  • school:physical
  • tooltip:
  • description:{$@spelldesc202820=Run Through occasionally awakens |cFFFFCC99The Dreadblades|r, unleashing a sweeping attack against all nearby enemies for ${$202822sw2 + $202823sw2} Physical damage, and healing you for ${$MHP*.05} per target hit.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.50
 
Main Gauche 23901 6.2% 240.7 1.69sec 39846 0 Direct 240.7 29248 58501 39846 36.2% 0.0%  

Stats details: main_gauche

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 240.65 240.65 0.00 0.00 0.0000 0.0000 9589062.40 14096830.03 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 153.47 63.77% 29248.46 26671 29338 29247.27 28815 29338 4488651 6598742 31.98
crit 87.18 36.23% 58501.19 53342 58676 58501.06 57435 58676 5100411 7498088 31.98
 
 

Action details: main_gauche

Static Values
  • id:86392
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:86392
  • name:Main Gauche
  • school:physical
  • tooltip:
  • description:A vicious attack that deals $86392sw2 Physical damage with your off-hand.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.10
 
Pistol Shot 7559 2.0% 43.8 8.61sec 69277 71389 Direct 43.8 44892 89780 69278 54.3% 0.0%  

Stats details: pistol_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.84 43.84 0.00 0.00 0.9704 0.0000 3037241.83 4465033.19 31.98 71388.93 71388.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.02 45.67% 44891.63 40890 44979 44889.97 43445 44979 898933 1321516 31.98
crit 23.82 54.33% 89780.09 81779 89957 89777.02 87504 89957 2138309 3143517 31.98
 
 

Action details: pistol_shot

Static Values
  • id:185763
  • school:physical
  • resource:energy
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.18
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit>=1+buff.broadsides.up&buff.opportunity.up&energy.time_to_max>2-talent.quick_draw.enabled
Spelldata
  • id:185763
  • name:Pistol Shot
  • school:physical
  • tooltip:Movement speed reduced by {$s3=50}%.
  • description:Draw a concealed pistol and fire a quick shot at an enemy, dealing {$s1=0} Physical damage and reducing movement speed by {$s3=50}% for {$d=6 seconds}. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
 
Potion of the Old War 11986 3.1% 26.3 5.49sec 179726 0 Direct 26.3 131875 264282 179729 36.1% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.34 26.34 0.00 0.00 0.0000 0.0000 4734316.08 6959893.09 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.82 63.86% 131874.69 121121 133233 131858.65 125780 133233 2218406 3261268 31.98
crit 9.52 36.14% 264282.49 242242 266466 264232.84 242242 266466 2515910 3698625 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Run Through 114039 29.6% 99.5 4.01sec 459115 486220 Direct 99.5 336469 672370 459111 36.5% 0.0%  

Stats details: run_through

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.47 99.47 0.00 0.00 0.9443 0.0000 45666740.12 67134433.65 31.98 486219.84 486219.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.15 63.49% 336468.79 258656 387984 336797.26 307772 360627 21247815 31236301 31.98
crit 36.32 36.51% 672369.57 517313 775969 673253.72 616100 741150 24418925 35898132 31.98
 
 

Action details: run_through

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2098
  • name:Run Through
  • school:physical
  • tooltip:Rooted.
  • description:Lunging finishing move that causes damage per combo point and has increased range: 1 point : ${$m1*1} damage 2 points: ${$m1*2} damage 3 points: ${$m1*3} damage 4 points: ${$m1*4} damage 5 points: ${$m1*5} damage{$?s193531=false}[ 6 points: ${$m1*6} damage][]
 
Saber Slash 58979 15.4% 217.0 1.85sec 109101 168401 Direct 217.0 80093 160200 109101 36.2% 0.0%  

Stats details: saber_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 216.95 216.95 0.00 0.00 0.6479 0.0000 23669703.66 34796706.44 31.98 168400.52 168400.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 138.39 63.79% 80092.93 73023 80325 80089.31 79124 80325 11083947 16294451 31.98
crit 78.56 36.21% 160199.74 146046 160650 160199.26 157667 160650 12585757 18502255 31.98
 
 

Action details: saber_slash

Static Values
  • id:193315
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.ss_useable
Spelldata
  • id:193315
  • name:Saber Slash
  • school:physical
  • tooltip:
  • description:Viciously slash an enemy, causing ${$sw1*$<mult>} Physical damage. Saber Slash has a {$s5=35}% chance to strike an additional time, making your next Pistol Shot free. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points; each time it strikes.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.75
 
Touch of the Grave 2635 0.7% 24.1 16.90sec 43756 0 Direct 24.1 43756 0 43756 0.0% 0.0%  

Stats details: touch_of_the_grave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.14 24.14 0.00 0.00 0.0000 0.0000 1056460.29 1056460.29 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.14 100.00% 43755.69 40074 44082 43752.09 42688 44082 1056460 1056460 0.00
 
 

Action details: touch_of_the_grave

Static Values
  • id:127802
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:127802
  • name:Touch of the Grave
  • school:shadow
  • tooltip:
  • description:{$@spelldesc5227=Your attacks and damaging spells have a chance to drain the target, dealing ${$max($AP,$SPH)*$pctD*(1+$@versadmg)} Shadow damage and healing you for the same amount. Additionally, you can breathe underwater indefinitely.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:1.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Vait
Adrenaline Rush 5.9 71.68sec

Stats details: adrenaline_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.89 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: adrenaline_rush

Static Values
  • id:13750
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.adrenaline_rush.up&energy.deficit>0
Spelldata
  • id:13750
  • name:Adrenaline Rush
  • school:physical
  • tooltip:Energy regeneration increased by {$s1=100}%. Attack speed increased by {$s2=20}%.
  • description:Increases your Energy regeneration rate by {$s1=100}% and your attack speed by {$s2=20}% for {$d=15 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Vait
  • harmful:false
  • if_expr:
 
Blade Flurry 10.0 29.99sec

Stats details: blade_flurry

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: blade_flurry

Static Values
  • id:13877
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:spell_targets.blade_flurry>=2&!buff.blade_flurry.up
Spelldata
  • id:13877
  • name:Blade Flurry
  • school:physical
  • tooltip:Attacking additional enemies. Energy regeneration reduced by $w1%.$?$w2!=0[ Non-Lethal poison application chance increased by $w2%.][]
  • description:While active, your melee attacks also strike all nearby enemies for {$s3=35}% of normal damage$?s56818[ and the application chance of Non-Lethal poisons is increased by {$s2=0}%][], but your Energy regeneration is reduced by {$s1=20}%. Lasts until cancelled.
 
Curse of the Dreadblades 4.8 91.86sec

Stats details: curse_of_the_dreadblades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.82 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: curse_of_the_dreadblades

Static Values
  • id:202665
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit>=4&(!talent.ghostly_strike.enabled|debuff.ghostly_strike.up)
Spelldata
  • id:202665
  • name:Curse of the Dreadblades
  • school:shadow
  • tooltip:Saber Slash and Pistol Shot will refill all of your combo points when used.
  • description:Invoke the Curse of the Dreadblades, causing each Saber Slash or Pistol Shot to fill your combo points. However, |cFFFFCC99The Dreadblades|r will consume {$202669s1=5}% of your current health when you use a finishing move for the next {$d=12 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Vait
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Vait
  • harmful:false
  • if_expr:
 
Gouge 19.9 18.18sec

Stats details: gouge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.93 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: gouge

Static Values
  • id:1776
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.dirty_tricks.enabled&combo_points.deficit>=1
Spelldata
  • id:1776
  • name:Gouge
  • school:physical
  • tooltip:Incapacitated.$?$w2!=0[ Damage taken increased by $w2%.][]
  • description:Gouges the eyes of an enemy target, incapacitating for {$d=4 seconds}. Damage will interrupt the effect. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
 
Marked for Death 12.7 24.15sec

Stats details: marked_for_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.73 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: marked_for_death

Static Values
  • id:137619
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:raid_event.adds.in>40
Spelldata
  • id:137619
  • name:Marked for Death
  • school:physical
  • tooltip:Marked for Death will reset upon death.
  • description:Marks the target, instantly generating {$s1=0} combo points. Cooldown reset if the target dies within {$d=60 seconds}.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Roll the Bones 16.3 24.24sec

Stats details: roll_the_bones

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.33 0.00 0.00 0.00 0.9517 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: roll_the_bones

Static Values
  • id:193316
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.slice_and_dice.enabled
Spelldata
  • id:193316
  • name:Roll the Bones
  • school:physical
  • tooltip:Gained a random combat enhancement.
  • description:Finishing move that rolls the dice of fate, providing a random combat enhancement. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=false}[ 6 points: 42 seconds][]
 
Sprint 8.3 49.45sec

Stats details: sprint

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.32 0.00 264.33 0.00 0.0000 0.2500 0.00 0.00 0.00 0.00 0.00
 
 

Action details: sprint

Static Values
  • id:2983
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.thraxis_tricksy_treads&!variable.ss_useable
Spelldata
  • id:2983
  • name:Sprint
  • school:physical
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:0.25
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Vanish 6.0 64.84sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.04 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:variable.stealth_condition
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Adrenaline Rush 5.9 0.0 71.2sec 71.2sec 21.78% 21.87% 0.0(0.0) 5.7

Buff details

  • buff initial source:Vait
  • cooldown name:buff_adrenaline_rush
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • adrenaline_rush_1:21.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:13750
  • name:Adrenaline Rush
  • tooltip:Energy regeneration increased by {$s1=100}%. Attack speed increased by {$s2=20}%.
  • description:Increases your Energy regeneration rate by {$s1=100}% and your attack speed by {$s2=20}% for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Alacrity 1.0 114.8 0.0sec 3.5sec 99.34% 100.00% 98.5(112.1) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_alacrity
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01

Stack Uptimes

  • alacrity_1:0.36%
  • alacrity_2:0.31%
  • alacrity_3:0.34%
  • alacrity_4:0.34%
  • alacrity_5:0.34%
  • alacrity_6:0.36%
  • alacrity_7:0.39%
  • alacrity_8:0.43%
  • alacrity_9:0.55%
  • alacrity_10:0.76%
  • alacrity_11:0.92%
  • alacrity_12:0.92%
  • alacrity_13:0.85%
  • alacrity_14:0.79%
  • alacrity_15:0.79%
  • alacrity_16:0.82%
  • alacrity_17:0.85%
  • alacrity_18:0.90%
  • alacrity_19:0.90%
  • alacrity_20:87.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=1}% for {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Blade Flurry 10.0 0.0 30.0sec 30.0sec 50.57% 50.57% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_blade_flurry
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • blade_flurry_1:50.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:13877
  • name:Blade Flurry
  • tooltip:Attacking additional enemies. Energy regeneration reduced by $w1%.$?$w2!=0[ Non-Lethal poison application chance increased by $w2%.][]
  • description:While active, your melee attacks also strike all nearby enemies for {$s3=35}% of normal damage$?s56818[ and the application chance of Non-Lethal poisons is increased by {$s2=0}%][], but your Energy regeneration is reduced by {$s1=20}%. Lasts until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
Blood Frenzy 14.2 8.8 28.5sec 17.2sec 45.32% 45.32% 8.8(8.8) 13.7

Buff details

  • buff initial source:Vait
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2957.63

Stack Uptimes

  • blood_frenzy_1:45.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your ranged and melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.12% 18.19% 0.0(0.0) 1.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Broadsides 4.1 0.0 74.7sec 74.7sec 27.65% 24.37% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_broadsides
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • broadsides_1:27.65%

Trigger Attempt Success

  • trigger_pct:98.76%

Spelldata details

  • id:193356
  • name:Broadsides
  • tooltip:Your attacks generate {$s1=1} additional combo point.
  • description:Your combo-generating abilities generate {$s1=1} additional combo point for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Buried Treasure 4.1 0.0 75.3sec 75.3sec 28.43% 27.37% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_buried_treasure
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • buried_treasure_1:28.43%

Trigger Attempt Success

  • trigger_pct:98.85%

Spelldata details

  • id:199600
  • name:Buried Treasure
  • tooltip:Increases Energy regeneration by {$s1=25}%.
  • description:Your base Energy regeneration is increased by {$s1=25}% for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Curse of the Dreadblades 4.8 0.0 91.9sec 91.9sec 14.20% 14.54% 0.0(0.0) 4.7

Buff details

  • buff initial source:Vait
  • cooldown name:buff_curse_of_the_dreadblades
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • curse_of_the_dreadblades_1:14.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202665
  • name:Curse of the Dreadblades
  • tooltip:Saber Slash and Pistol Shot will refill all of your combo points when used.
  • description:Invoke the Curse of the Dreadblades, causing each Saber Slash or Pistol Shot to fill your combo points. However, |cFFFFCC99The Dreadblades|r will consume {$202669s1=5}% of your current health when you use a finishing move for the next {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:90.00
  • default_chance:101.00%
Grand Melee 4.1 0.0 74.1sec 74.1sec 28.47% 27.40% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_grand_melee
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.67

Stack Uptimes

  • grand_melee_1:28.47%

Trigger Attempt Success

  • trigger_pct:98.78%

Spelldata details

  • id:193358
  • name:Grand Melee
  • tooltip:Attack speed increased by {$s1=50}%. Leech increased by {$s2=25}%.
  • description:Increases your attack speed by {$s1=50}% and your Leech by {$s2=25}% for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hidden Blade 7.0 0.0 58.5sec 64.8sec 4.26% 5.21% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_hidden_blade
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • hidden_blade_1:4.26%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202754
  • name:Hidden Blade
  • tooltip:Your next Saber Slash has 100% chance to strike a second time.
  • description:{$@spelldesc202753=Successfully using Ambush guarantees your next Saber Slash will strike an additional time.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Jolly Roger 4.1 0.0 74.1sec 74.1sec 28.26% 28.10% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_jolly_roger
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • jolly_roger_1:28.26%

Trigger Attempt Success

  • trigger_pct:98.90%

Spelldata details

  • id:199603
  • name:Jolly Roger
  • tooltip:Saber Slash has an additional {$s1=25}% chance of striking an additional time.
  • description:Causes Saber Slash to have an additional {$s1=25}% chance of striking an additional time for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Opportunity 44.8 18.1 8.9sec 6.3sec 37.30% 37.30% 18.1(18.1) 0.6

Buff details

  • buff initial source:Vait
  • cooldown name:buff_opportunity
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • opportunity_1:37.30%

Trigger Attempt Success

  • trigger_pct:42.10%

Spelldata details

  • id:195627
  • name:Opportunity
  • tooltip:Your next Pistol Shot is free.
  • description:{$@spelldesc193315=Viciously slash an enemy, causing ${$sw1*$<mult>} Physical damage. Saber Slash has a {$s5=35}% chance to strike an additional time, making your next Pistol Shot free. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points; each time it strikes.|r}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of the Old War 2.0 0.0 111.4sec 0.0sec 12.15% 12.15% 0.0(0.0) 2.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 32.9 1.9 11.9sec 11.3sec 11.96% 11.96% 1.9(1.9) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:11.96%

Trigger Attempt Success

  • trigger_pct:100.00%
Roll the Bones 2.9 13.4 129.6sec 24.4sec 98.83% 98.83% 13.4(13.4) 1.9

Buff details

  • buff initial source:Vait
  • cooldown name:buff_roll_the_bones
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roll_the_bones_1:98.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193316
  • name:Roll the Bones
  • tooltip:Gained a random combat enhancement.
  • description:Finishing move that rolls the dice of fate, providing a random combat enhancement. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=false}[ 6 points: 42 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Shark Infested Waters 4.1 0.0 75.8sec 75.8sec 30.18% 48.69% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_shark_infested_waters
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • shark_infested_waters_1:30.18%

Trigger Attempt Success

  • trigger_pct:99.10%

Spelldata details

  • id:193357
  • name:Shark Infested Waters
  • tooltip:Critical Strike chance increased by {$s1=25}%.
  • description:Increases Critical Strike chance by {$s1=25}% for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Sprint 8.3 0.0 49.2sec 49.2sec 16.50% 12.05% 264.3(264.3) 8.2

Buff details

  • buff initial source:Vait
  • cooldown name:buff_sprint
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • sprint_1:16.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2983
  • name:Sprint
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
  • max_stacks:0
  • duration:8.00
  • cooldown:120.00
  • default_chance:0.00%
Stealth 1.0 0.0 175.2sec 150.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:200.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stealth_1:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=50}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for $31666d after deal {$31223s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
True Bearing 4.1 0.0 81.7sec 81.7sec 43.78% 43.82% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_true_bearing
  • max_stacks:1
  • duration:0.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:2.00

Stack Uptimes

  • true_bearing_1:43.78%

Trigger Attempt Success

  • trigger_pct:99.45%

Spelldata details

  • id:193359
  • name:True Bearing
  • tooltip:Finishers reduce the remaining cooldown on many of your abilities by {$s1=2} sec per combo point.
  • description:For the duration of Roll the Bones, each time you use a finishing move, you reduce the remaining cooldown on Adrenaline Rush, Sprint, Between the Eyes, Vanish, Blind, Cloak of Shadows, Riposte, Grappling Hook, Cannonball Barrage, Killing Spree, Marked for Death, and Death from Above by {$s1=2} sec per combo point spent.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Vanish 6.0 0.0 64.6sec 64.6sec 0.20% 0.20% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vanish_1:0.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Vait
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Vait
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:Vait
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Vait
ambush Energy 7.0 421.5 60.0 60.0 2495.7
ghostly_strike Energy 27.0 810.2 30.0 30.0 1989.0
roll_the_bones Energy 16.3 212.3 13.0 13.0 0.0
roll_the_bones Combo Points 16.3 89.8 5.5 5.5 0.0
run_through Energy 99.5 2287.8 23.0 23.0 19961.3
run_through Combo Points 99.5 570.8 5.7 5.7 80008.4
saber_slash Energy 217.0 7481.2 34.5 34.5 3163.9
Resource Gains Type Count Total Average Overflow
marked_for_death Combo Points 12.73 61.41 (9.25%) 4.82 2.25 3.53%
gouge Combo Points 19.92 19.92 (3.00%) 1.00 0.00 0.00%
ghostly_strike Combo Points 27.01 27.01 (4.07%) 1.00 0.00 0.00%
pistol_shot Combo Points 43.84 43.84 (6.60%) 1.00 0.00 0.00%
saber_slash Combo Points 216.95 201.33 (30.33%) 0.93 15.62 7.20%
adrenaline_rush Energy 310.96 1379.26 (12.37%) 4.44 197.75 12.54%
ambush Combo Points 7.03 14.05 (2.12%) 2.00 0.00 0.02%
energy_regen Energy 1426.77 6936.35 (62.20%) 4.86 237.98 3.32%
combat_potency Energy 179.48 2835.44 (25.43%) 15.80 36.24 1.26%
Broadsides Combo Points 75.68 67.73 (10.20%) 0.90 7.95 10.50%
Ruthlessness Combo Points 115.80 132.14 (19.91%) 1.14 0.00 0.00%
Curse of the Dreadblades Combo Points 27.93 96.36 (14.52%) 3.45 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 27.81 27.96
Combo Points 1.66 1.65
Combat End Resource Mean Min Max
Energy 38.07 0.04 100.00
Combo Points 3.20 1.00 6.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 2.5%

Procs

Count Interval
Roll the Bones: 1 buff 9.7 37.1sec
Roll the Bones: 2 buffs 5.8 64.4sec
Roll the Bones: 3 buffs 0.6 140.0sec
Roll the Bones: 6 buffs 0.3 154.6sec

Statistics & Data Analysis

Fight Length
Sample Data Vait Fight Length
Count 9999
Mean 401.00
Minimum 308.02
Maximum 501.87
Spread ( max - min ) 193.85
Range [ ( max - min ) / 2 * 100% ] 24.17%
DPS
Sample Data Vait Damage Per Second
Count 9999
Mean 386231.81
Minimum 300890.16
Maximum 517805.58
Spread ( max - min ) 216915.43
Range [ ( max - min ) / 2 * 100% ] 28.08%
Standard Deviation 28539.6971
5th Percentile 344810.30
95th Percentile 437261.50
( 95th Percentile - 5th Percentile ) 92451.20
Mean Distribution
Standard Deviation 285.4112
95.00% Confidence Intervall ( 385672.42 - 386791.21 )
Normalized 95.00% Confidence Intervall ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 209
0.1% Error 20974
0.1 Scale Factor Error with Delta=300 6953162
0.05 Scale Factor Error with Delta=300 27812650
0.01 Scale Factor Error with Delta=300 695316261
Priority Target DPS
Sample Data Vait Priority Target Damage Per Second
Count 9999
Mean 271111.00
Minimum 214183.03
Maximum 353728.62
Spread ( max - min ) 139545.59
Range [ ( max - min ) / 2 * 100% ] 25.74%
Standard Deviation 15457.1777
5th Percentile 248731.86
95th Percentile 298887.22
( 95th Percentile - 5th Percentile ) 50155.36
Mean Distribution
Standard Deviation 154.5795
95.00% Confidence Intervall ( 270808.03 - 271413.97 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 124
0.1% Error 12487
0.1 Scale Factor Error with Delta=300 2039595
0.05 Scale Factor Error with Delta=300 8158382
0.01 Scale Factor Error with Delta=300 203959560
DPS(e)
Sample Data Vait Damage Per Second (Effective)
Count 9999
Mean 386231.81
Minimum 300890.16
Maximum 517805.58
Spread ( max - min ) 216915.43
Range [ ( max - min ) / 2 * 100% ] 28.08%
Damage
Sample Data Vait Damage
Count 9999
Mean 154071315.74
Minimum 109374001.67
Maximum 209308272.86
Spread ( max - min ) 99934271.18
Range [ ( max - min ) / 2 * 100% ] 32.43%
DTPS
Sample Data Vait Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Vait Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Vait Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Vait Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Vait Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Vait Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data VaitTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Vait Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=flask_of_the_seventh_demon
1 0.00 augmentation,name=defiled
2 0.00 food,name=seedbattered_fish_plate
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 stealth
5 0.00 potion,name=old_war
6 0.00 marked_for_death,if=raid_event.adds.in>40
7 0.00 roll_the_bones,if=!talent.slice_and_dice.enabled
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=rtb_reroll,value=!talent.slice_and_dice.enabled&(rtb_buffs<=1&!rtb_list.any.6&((!buff.curse_of_the_dreadblades.up&!buff.adrenaline_rush.up)|!rtb_list.any.5))
Condition to continue rerolling RtB (2- or not TB alone or not SIW alone during CDs); If SnD: consider that you never have to reroll.
0.00 variable,name=ss_useable_noreroll,value=(combo_points<5+talent.deeper_stratagem.enabled-(buff.broadsides.up|buff.jolly_roger.up)-(talent.alacrity.enabled&buff.alacrity.stack<=4))
Condition to use Saber Slash when not rerolling RtB or when using SnD
0.00 variable,name=ss_useable,value=(talent.anticipation.enabled&combo_points<4)|(!talent.anticipation.enabled&((variable.rtb_reroll&combo_points<4+talent.deeper_stratagem.enabled)|(!variable.rtb_reroll&variable.ss_useable_noreroll)))
Condition to use Saber Slash, when you have RtB or not
8 0.00 call_action_list,name=bf
Normal rotation
9 0.00 call_action_list,name=cds
A 0.00 call_action_list,name=stealth,if=stealthed|cooldown.vanish.up|cooldown.shadowmeld.up
Conditions are here to avoid worthless check if nothing is available
0.00 death_from_above,if=energy.time_to_max>2&!variable.ss_useable_noreroll
0.00 slice_and_dice,if=!variable.ss_useable&buff.slice_and_dice.remains<target.time_to_die&buff.slice_and_dice.remains<(1+combo_points)*1.8
B 16.33 roll_the_bones,if=!variable.ss_useable&buff.roll_the_bones.remains<target.time_to_die&(buff.roll_the_bones.remains<=3|variable.rtb_reroll)
0.00 killing_spree,if=energy.time_to_max>5|energy<15
C 0.00 call_action_list,name=build
D 0.00 call_action_list,name=finish,if=!variable.ss_useable
E 20.02 gouge,if=talent.dirty_tricks.enabled&combo_points.deficit>=1
Gouge is used as a CP Generator while nothing else is available and you have Dirty Tricks talent. It's unlikely that you'll be able to do this optimally in-game since it requires to move in front of the target, but it's here so you can quantifiy its value.
actions.bf Blade Flurry
# count action,conditions
F 10.00 cancel_buff,name=blade_flurry,if=equipped.shivarran_symmetry&cooldown.blade_flurry.up&buff.blade_flurry.up&spell_targets.blade_flurry>=2|spell_targets.blade_flurry<2&buff.blade_flurry.up
G 10.00 blade_flurry,if=spell_targets.blade_flurry>=2&!buff.blade_flurry.up
actions.build Builders
# count action,conditions
H 27.01 ghostly_strike,if=combo_points.deficit>=1+buff.broadsides.up&!buff.curse_of_the_dreadblades.up&(debuff.ghostly_strike.remains<debuff.ghostly_strike.duration*0.3|(cooldown.curse_of_the_dreadblades.remains<3&debuff.ghostly_strike.remains<14))&(combo_points>=3|(variable.rtb_reroll&time>=10))
I 43.84 pistol_shot,if=combo_points.deficit>=1+buff.broadsides.up&buff.opportunity.up&energy.time_to_max>2-talent.quick_draw.enabled
J 149.62 saber_slash,if=variable.ss_useable
actions.cds Cooldowns
# count action,conditions
K 1.00 potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.adrenaline_rush.up
0.00 blood_fury
0.00 berserking
0.00 arcane_torrent,if=energy.deficit>40
0.00 cannonball_barrage,if=spell_targets.cannonball_barrage>=1
L 5.90 adrenaline_rush,if=!buff.adrenaline_rush.up&energy.deficit>0
M 12.73 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|((raid_event.adds.in>40|buff.true_bearing.remains>15)&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)
N 8.33 sprint,if=equipped.thraxis_tricksy_treads&!variable.ss_useable
O 4.82 curse_of_the_dreadblades,if=combo_points.deficit>=4&(!talent.ghostly_strike.enabled|debuff.ghostly_strike.up)
actions.finish Finishers
# count action,conditions
0.00 between_the_eyes,if=equipped.greenskins_waterlogged_wristcuffs&buff.shark_infested_waters.up
P 99.47 run_through,if=!talent.death_from_above.enabled|energy.time_to_max<cooldown.death_from_above.remains+3.5
actions.stealth Stealth
# count action,conditions
0.00 variable,name=stealth_condition,value=(combo_points.deficit>=2+2*(talent.ghostly_strike.enabled&!debuff.ghostly_strike.up)+buff.broadsides.up&energy>60&!buff.jolly_roger.up&!buff.hidden_blade.up&!buff.curse_of_the_dreadblades.up)
Condition to use stealth abilities
Q 7.03 ambush
R 6.05 vanish,if=variable.stealth_condition
0.00 shadowmeld,if=variable.stealth_condition

Sample Sequence

01245QLJHNBOJBJPJPJPJPJPJPJJHJPGIJPJJIHPJIJPMPJIJPFJIJHPJIJPGJJPJJHBMPIRQEJPJIJFPJHEJNPJJGJJEPJHIJPIOJBMBJPLKJPFJPJPEJPJHIPJGJJIPJEHJJPMPIJEFRQPJIHJPEGJJIPJJJHBEJIPJJIPMPJFIJNPIJHIPJIGJPJIJIPEJHIPOJPMPJPFEJBIBJBJHJGPJJJIPJHIPJJPMPIJFIPJJHIPJEJGPJIPJJHEPJIJPMPJFERQBHJJBIGJBJJIBJEHJPIOJPMPJLPFIPJNPJPJPJPJHGJJPJIJPIJHJEPMPJJFJIBJEHJPIJJIPJEJHPJIJEPJJJINPRQHEJPJIJBIJIHPLJJEJPOJPIPJPJNPJPJPJPIPRQHJPJEJJPJHIJP

Sample Sequence Table

time name target resources buffs
Pre flask Vait 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre augmentation Vait 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre food Vait 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre stealth Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points stealth
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points stealth, potion_of_the_old_war
0:00.000 ambush Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points stealth, potion_of_the_old_war
0:01.004 adrenaline_rush Fluffy_Pillow 89.8/100: 90% energy | 2.0/6: 33% combo_points bloodlust, hidden_blade, potion_of_the_old_war
0:01.004 saber_slash Fluffy_Pillow 89.8/100: 90% energy | 2.0/6: 33% combo_points bloodlust, adrenaline_rush, hidden_blade, potion_of_the_old_war
0:01.809 ghostly_strike Fluffy_Pillow 68.5/100: 68% energy | 4.0/6: 67% combo_points bloodlust, adrenaline_rush, opportunity, potion_of_the_old_war
0:02.613 sprint Fluffy_Pillow 83.0/100: 83% energy | 5.0/6: 83% combo_points bloodlust, adrenaline_rush, opportunity, potion_of_the_old_war
0:02.613 roll_the_bones Fluffy_Pillow 83.0/100: 83% energy | 5.0/6: 83% combo_points bloodlust, adrenaline_rush, opportunity, sprint, potion_of_the_old_war
0:03.417 curse_of_the_dreadblades Fluffy_Pillow 98.9/100: 99% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity, broadsides, roll_the_bones, potion_of_the_old_war
0:03.417 saber_slash Fluffy_Pillow 98.9/100: 99% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity, broadsides, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:04.219 roll_the_bones Fluffy_Pillow 77.7/100: 78% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity, broadsides, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:05.023 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(2), jolly_roger, buried_treasure, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:05.828 run_through Fluffy_Pillow 86.5/100: 86% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(2), jolly_roger, buried_treasure, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:06.634 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(3), jolly_roger, buried_treasure, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:07.438 run_through Fluffy_Pillow 86.8/100: 87% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(3), jolly_roger, buried_treasure, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:08.244 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(4), jolly_roger, buried_treasure, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:09.048 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(4), jolly_roger, buried_treasure, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:09.851 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(5), jolly_roger, buried_treasure, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:10.656 run_through Fluffy_Pillow 87.6/100: 88% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(5), jolly_roger, buried_treasure, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:11.461 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(7), jolly_roger, buried_treasure, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:12.266 Waiting 0.800 sec 88.3/100: 88% energy | 6.0/6: 100% combo_points bloodlust, raid_movement, adrenaline_rush, opportunity, alacrity(7), jolly_roger, buried_treasure, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:13.066 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(7), jolly_roger, buried_treasure, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:13.871 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(8), jolly_roger, buried_treasure, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:14.675 run_through Fluffy_Pillow 88.6/100: 89% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(8), jolly_roger, buried_treasure, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
0:15.480 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(9), jolly_roger, buried_treasure, roll_the_bones, potion_of_the_old_war
0:16.284 saber_slash Fluffy_Pillow 82.2/100: 82% energy | 2.0/6: 33% combo_points bloodlust, opportunity, alacrity(9), jolly_roger, buried_treasure, roll_the_bones, potion_of_the_old_war
0:17.289 ghostly_strike Fluffy_Pillow 56.5/100: 56% energy | 3.0/6: 50% combo_points bloodlust, opportunity, alacrity(9), jolly_roger, buried_treasure, roll_the_bones, potion_of_the_old_war
0:18.295 saber_slash Fluffy_Pillow 66.8/100: 67% energy | 4.0/6: 67% combo_points bloodlust, alacrity(9), jolly_roger, buried_treasure, roll_the_bones, potion_of_the_old_war
0:19.299 run_through Fluffy_Pillow 41.2/100: 41% energy | 6.0/6: 100% combo_points bloodlust, opportunity, alacrity(9), jolly_roger, buried_treasure, roll_the_bones, potion_of_the_old_war
0:20.303 blade_flurry Fluffy_Pillow 42.7/100: 43% energy | 2.0/6: 33% combo_points bloodlust, raid_movement, opportunity, alacrity(10), jolly_roger, buried_treasure, roll_the_bones, potion_of_the_old_war
0:20.303 pistol_shot Fluffy_Pillow 42.7/100: 43% energy | 2.0/6: 33% combo_points bloodlust, raid_movement, blade_flurry, opportunity, alacrity(10), jolly_roger, buried_treasure, roll_the_bones, potion_of_the_old_war
0:21.306 Waiting 1.900 sec 65.5/100: 65% energy | 3.0/6: 50% combo_points bloodlust, raid_movement, blade_flurry, alacrity(10), jolly_roger, buried_treasure, roll_the_bones, potion_of_the_old_war
0:23.206 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points bloodlust, blade_flurry, alacrity(10), jolly_roger, buried_treasure, roll_the_bones
0:24.211 run_through Fluffy_Pillow 73.8/100: 74% energy | 5.0/6: 83% combo_points bloodlust, blade_flurry, opportunity, alacrity(10), jolly_roger, buried_treasure, roll_the_bones, blood_frenzy
0:25.217 saber_slash Fluffy_Pillow 75.7/100: 76% energy | 1.0/6: 17% combo_points bloodlust, blade_flurry, opportunity, alacrity(11), jolly_roger, buried_treasure, roll_the_bones, blood_frenzy
0:26.221 saber_slash Fluffy_Pillow 50.5/100: 51% energy | 2.0/6: 33% combo_points bloodlust, blade_flurry, opportunity, alacrity(11), jolly_roger, buried_treasure, roll_the_bones, blood_frenzy
0:27.225 pistol_shot Fluffy_Pillow 25.4/100: 25% energy | 3.0/6: 50% combo_points bloodlust, blade_flurry, opportunity, alacrity(11), jolly_roger, buried_treasure, roll_the_bones, blood_frenzy
0:28.229 Waiting 0.800 sec 50.3/100: 50% energy | 4.0/6: 67% combo_points bloodlust, raid_movement, blade_flurry, alacrity(11), jolly_roger, buried_treasure, roll_the_bones, blood_frenzy
0:29.029 ghostly_strike Fluffy_Pillow 70.1/100: 70% energy | 4.0/6: 67% combo_points bloodlust, blade_flurry, alacrity(11), jolly_roger, buried_treasure, roll_the_bones, blood_frenzy
0:30.033 run_through Fluffy_Pillow 64.9/100: 65% energy | 5.0/6: 83% combo_points bloodlust, blade_flurry, alacrity(11), jolly_roger, buried_treasure, roll_the_bones, blood_frenzy
0:31.037 saber_slash Fluffy_Pillow 67.0/100: 67% energy | 1.0/6: 17% combo_points bloodlust, blade_flurry, alacrity(12), jolly_roger, buried_treasure, roll_the_bones, blood_frenzy
0:32.042 pistol_shot Fluffy_Pillow 42.1/100: 42% energy | 3.0/6: 50% combo_points bloodlust, blade_flurry, opportunity, alacrity(12), jolly_roger, buried_treasure, roll_the_bones, blood_frenzy
0:33.047 saber_slash Fluffy_Pillow 67.2/100: 67% energy | 4.0/6: 67% combo_points bloodlust, blade_flurry, alacrity(12), jolly_roger, buried_treasure, roll_the_bones, blood_frenzy
0:34.052 run_through Fluffy_Pillow 57.7/100: 58% energy | 6.0/6: 100% combo_points bloodlust, blade_flurry, opportunity, alacrity(12), jolly_roger, buried_treasure, roll_the_bones
0:35.056 marked_for_death Fluffy_Pillow_Add1 58.2/100: 58% energy | 1.0/6: 17% combo_points bloodlust, blade_flurry, opportunity, alacrity(13), jolly_roger, buried_treasure, roll_the_bones
0:35.056 run_through Fluffy_Pillow 58.2/100: 58% energy | 6.0/6: 100% combo_points bloodlust, blade_flurry, opportunity, alacrity(13), jolly_roger, buried_treasure, roll_the_bones
0:36.059 saber_slash Fluffy_Pillow 58.8/100: 59% energy | 1.0/6: 17% combo_points bloodlust, blade_flurry, opportunity, alacrity(14), jolly_roger, buried_treasure, roll_the_bones
0:37.064 pistol_shot Fluffy_Pillow 32.4/100: 32% energy | 2.0/6: 33% combo_points bloodlust, blade_flurry, opportunity, alacrity(14), jolly_roger, buried_treasure, roll_the_bones
0:38.069 saber_slash Fluffy_Pillow 72.1/100: 72% energy | 3.0/6: 50% combo_points bloodlust, blade_flurry, alacrity(14), jolly_roger, buried_treasure, roll_the_bones
0:39.074 run_through Fluffy_Pillow 77.8/100: 78% energy | 5.0/6: 83% combo_points bloodlust, blade_flurry, opportunity, alacrity(14), jolly_roger, buried_treasure, roll_the_bones
0:40.079 cancel_buff Fluffy_Pillow 78.7/100: 79% energy | 1.0/6: 17% combo_points bloodlust, blade_flurry, opportunity, alacrity(15), jolly_roger, buried_treasure, roll_the_bones
0:40.079 saber_slash Fluffy_Pillow 78.7/100: 79% energy | 1.0/6: 17% combo_points bloodlust, opportunity, alacrity(15), jolly_roger, buried_treasure, roll_the_bones
0:41.083 pistol_shot Fluffy_Pillow 49.7/100: 50% energy | 2.0/6: 33% combo_points opportunity, alacrity(15), jolly_roger, buried_treasure, roll_the_bones
0:42.087 saber_slash Fluffy_Pillow 85.4/100: 85% energy | 3.0/6: 50% combo_points alacrity(15), jolly_roger, buried_treasure, roll_the_bones
0:43.091 ghostly_strike Fluffy_Pillow 55.9/100: 56% energy | 5.0/6: 83% combo_points opportunity, alacrity(15), jolly_roger, buried_treasure, roll_the_bones, blood_frenzy
0:44.095 Waiting 0.900 sec 47.2/100: 47% energy | 6.0/6: 100% combo_points raid_movement, opportunity, alacrity(15), jolly_roger, buried_treasure, roll_the_bones, blood_frenzy
0:44.995 run_through Fluffy_Pillow 66.3/100: 66% energy | 6.0/6: 100% combo_points opportunity, alacrity(15), jolly_roger, buried_treasure, roll_the_bones, blood_frenzy
0:46.000 saber_slash Fluffy_Pillow 80.9/100: 81% energy | 1.0/6: 17% combo_points opportunity, alacrity(16), jolly_roger, buried_treasure, roll_the_bones, blood_frenzy
0:47.004 pistol_shot Fluffy_Pillow 52.3/100: 52% energy | 3.0/6: 50% combo_points opportunity, alacrity(16), jolly_roger, buried_treasure, roll_the_bones, blood_frenzy
0:48.007 saber_slash Fluffy_Pillow 89.8/100: 90% energy | 4.0/6: 67% combo_points alacrity(16), jolly_roger, buried_treasure, roll_the_bones, blood_frenzy
0:49.013 run_through Fluffy_Pillow 61.3/100: 61% energy | 6.0/6: 100% combo_points opportunity, alacrity(16), jolly_roger, buried_treasure, roll_the_bones, blood_frenzy
0:50.016 blade_flurry Fluffy_Pillow 76.0/100: 76% energy | 2.0/6: 33% combo_points raid_movement, opportunity, alacrity(17), jolly_roger, buried_treasure, roll_the_bones, blood_frenzy
0:50.016 Waiting 3.100 sec 76.0/100: 76% energy | 2.0/6: 33% combo_points raid_movement, blade_flurry, opportunity, alacrity(17), jolly_roger, buried_treasure, roll_the_bones, blood_frenzy
0:53.116 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points blade_flurry, opportunity, alacrity(17), jolly_roger, buried_treasure, roll_the_bones
0:54.120 saber_slash Fluffy_Pillow 68.7/100: 69% energy | 3.0/6: 50% combo_points blade_flurry, opportunity, alacrity(17), jolly_roger, buried_treasure, roll_the_bones
0:55.123 run_through Fluffy_Pillow 69.3/100: 69% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, alacrity(17), jolly_roger, buried_treasure, roll_the_bones
0:56.126 saber_slash Fluffy_Pillow 81.1/100: 81% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(18), jolly_roger, buried_treasure, roll_the_bones
0:57.130 saber_slash Fluffy_Pillow 66.0/100: 66% energy | 3.0/6: 50% combo_points blade_flurry, opportunity, alacrity(18), jolly_roger, buried_treasure, roll_the_bones
0:58.132 ghostly_strike Fluffy_Pillow 34.7/100: 35% energy | 4.0/6: 67% combo_points blade_flurry, opportunity, alacrity(18), jolly_roger, buried_treasure, roll_the_bones
0:59.135 roll_the_bones Fluffy_Pillow 19.8/100: 20% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, alacrity(18)
1:00.140 marked_for_death Fluffy_Pillow_Add1 22.0/100: 22% energy | 1.0/6: 17% combo_points raid_movement, blade_flurry, opportunity, alacrity(19), grand_melee, true_bearing, roll_the_bones
1:00.140 Waiting 0.898 sec 22.0/100: 22% energy | 6.0/6: 100% combo_points raid_movement, blade_flurry, opportunity, alacrity(19), grand_melee, true_bearing, roll_the_bones
1:01.038 run_through Fluffy_Pillow 35.6/100: 36% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(19), grand_melee, true_bearing, roll_the_bones
1:02.044 pistol_shot Fluffy_Pillow 43.9/100: 44% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones
1:03.049 vanish Fluffy_Pillow 75.3/100: 75% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), grand_melee, true_bearing, roll_the_bones
1:03.049 ambush Fluffy_Pillow 75.3/100: 75% energy | 2.0/6: 33% combo_points blade_flurry, vanish, alacrity(20), grand_melee, true_bearing, roll_the_bones
1:04.053 gouge Fluffy_Pillow 46.6/100: 47% energy | 4.0/6: 67% combo_points blade_flurry, alacrity(20), grand_melee, true_bearing, roll_the_bones, hidden_blade
1:05.057 saber_slash Fluffy_Pillow 77.9/100: 78% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), grand_melee, true_bearing, roll_the_bones, hidden_blade
1:06.062 run_through Fluffy_Pillow 43.2/100: 43% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), grand_melee, true_bearing, roll_the_bones
1:07.067 saber_slash Fluffy_Pillow 51.6/100: 52% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), grand_melee, true_bearing, roll_the_bones
1:08.072 pistol_shot Fluffy_Pillow 16.9/100: 17% energy | 4.0/6: 67% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones
1:09.076 Waiting 0.200 sec 48.2/100: 48% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), grand_melee, true_bearing, roll_the_bones
1:09.276 saber_slash Fluffy_Pillow 51.3/100: 51% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), grand_melee, true_bearing, roll_the_bones
1:10.280 cancel_buff Fluffy_Pillow 16.6/100: 17% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), grand_melee, true_bearing, roll_the_bones
1:10.280 Waiting 0.513 sec 16.6/100: 17% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, true_bearing, roll_the_bones
1:10.793 run_through Fluffy_Pillow 25.0/100: 25% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, true_bearing, roll_the_bones
1:11.798 Waiting 0.200 sec 34.5/100: 34% energy | 2.0/6: 33% combo_points alacrity(20), grand_melee, true_bearing, roll_the_bones
1:11.998 saber_slash Fluffy_Pillow 53.8/100: 54% energy | 2.0/6: 33% combo_points alacrity(20), grand_melee, true_bearing, roll_the_bones
1:13.003 ghostly_strike Fluffy_Pillow 36.2/100: 36% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, true_bearing, roll_the_bones
1:14.008 gouge Fluffy_Pillow 38.7/100: 39% energy | 4.0/6: 67% combo_points alacrity(20), grand_melee, true_bearing, roll_the_bones
1:15.057 saber_slash Fluffy_Pillow 71.9/100: 72% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, true_bearing, roll_the_bones
1:16.062 Waiting 0.400 sec 38.4/100: 38% energy | 6.0/6: 100% combo_points raid_movement, alacrity(20), grand_melee, true_bearing, roll_the_bones
1:16.462 sprint Fluffy_Pillow 45.0/100: 45% energy | 6.0/6: 100% combo_points raid_movement, alacrity(20), grand_melee, true_bearing, roll_the_bones
1:16.613 Waiting 0.300 sec 47.5/100: 47% energy | 6.0/6: 100% combo_points raid_movement, sprint, alacrity(20), grand_melee, true_bearing, roll_the_bones
1:16.913 run_through Fluffy_Pillow 52.4/100: 52% energy | 6.0/6: 100% combo_points sprint, alacrity(20), grand_melee, true_bearing, roll_the_bones
1:17.917 saber_slash Fluffy_Pillow 77.9/100: 78% energy | 1.0/6: 17% combo_points sprint, alacrity(20), grand_melee, true_bearing, roll_the_bones
1:18.921 saber_slash Fluffy_Pillow 60.3/100: 60% energy | 2.0/6: 33% combo_points sprint, alacrity(20), grand_melee, true_bearing, roll_the_bones
1:19.925 Waiting 0.100 sec 26.8/100: 27% energy | 3.0/6: 50% combo_points sprint, alacrity(20), grand_melee, true_bearing, roll_the_bones
1:20.025 blade_flurry Fluffy_Pillow 28.4/100: 28% energy | 3.0/6: 50% combo_points raid_movement, sprint, alacrity(20), grand_melee, true_bearing, roll_the_bones
1:20.025 Waiting 2.000 sec 28.4/100: 28% energy | 3.0/6: 50% combo_points raid_movement, blade_flurry, sprint, alacrity(20), grand_melee, true_bearing, roll_the_bones
1:22.025 saber_slash Fluffy_Pillow 59.0/100: 59% energy | 3.0/6: 50% combo_points blade_flurry, sprint, alacrity(20), grand_melee, true_bearing, roll_the_bones
1:23.031 Waiting 0.600 sec 41.5/100: 42% energy | 4.0/6: 67% combo_points blade_flurry, sprint, alacrity(20), grand_melee, true_bearing, roll_the_bones, blood_frenzy
1:23.631 saber_slash Fluffy_Pillow 51.4/100: 51% energy | 4.0/6: 67% combo_points blade_flurry, sprint, alacrity(20), grand_melee, true_bearing, roll_the_bones, blood_frenzy
1:24.634 gouge Fluffy_Pillow 17.9/100: 18% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), grand_melee, true_bearing, roll_the_bones, blood_frenzy
1:25.639 run_through Fluffy_Pillow 34.5/100: 34% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), grand_melee, true_bearing, roll_the_bones, blood_frenzy
1:26.643 Waiting 1.300 sec 28.0/100: 28% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), grand_melee, true_bearing, roll_the_bones, blood_frenzy
1:27.943 saber_slash Fluffy_Pillow 65.5/100: 65% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), grand_melee, true_bearing, roll_the_bones, blood_frenzy
1:28.946 ghostly_strike Fluffy_Pillow 64.0/100: 64% energy | 3.0/6: 50% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones, blood_frenzy
1:29.950 pistol_shot Fluffy_Pillow 66.5/100: 67% energy | 4.0/6: 67% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones, blood_frenzy
1:30.954 saber_slash Fluffy_Pillow 99.1/100: 99% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), grand_melee, true_bearing, roll_the_bones, blood_frenzy
1:31.957 run_through Fluffy_Pillow 65.6/100: 66% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones, blood_frenzy
1:32.962 pistol_shot Fluffy_Pillow 58.0/100: 58% energy | 1.0/6: 17% combo_points raid_movement, blade_flurry, opportunity, alacrity(20), grand_melee, true_bearing, roll_the_bones
1:33.966 curse_of_the_dreadblades Fluffy_Pillow 89.3/100: 89% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), grand_melee, true_bearing, roll_the_bones
1:33.966 saber_slash Fluffy_Pillow 89.3/100: 89% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), grand_melee, true_bearing, roll_the_bones, curse_of_the_dreadblades
1:34.970 roll_the_bones Fluffy_Pillow 70.6/100: 71% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), grand_melee, true_bearing, roll_the_bones, curse_of_the_dreadblades
1:35.974 marked_for_death Fluffy_Pillow_Add1 76.8/100: 77% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), buried_treasure, roll_the_bones, curse_of_the_dreadblades
1:35.974 roll_the_bones Fluffy_Pillow 76.8/100: 77% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), buried_treasure, roll_the_bones, curse_of_the_dreadblades
1:36.977 saber_slash Fluffy_Pillow 79.1/100: 79% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
1:37.979 run_through Fluffy_Pillow 60.4/100: 60% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
1:38.984 adrenaline_rush Fluffy_Pillow 68.7/100: 69% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
1:39.004 potion Fluffy_Pillow 85.0/100: 85% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
1:39.004 saber_slash Fluffy_Pillow 85.0/100: 85% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
1:39.808 run_through Fluffy_Pillow 59.5/100: 60% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
1:40.613 cancel_buff Fluffy_Pillow 77.1/100: 77% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
1:40.613 saber_slash Fluffy_Pillow 77.1/100: 77% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
1:41.419 run_through Fluffy_Pillow 53.5/100: 54% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
1:42.223 saber_slash Fluffy_Pillow 56.9/100: 57% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
1:43.024 run_through Fluffy_Pillow 33.2/100: 33% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
1:43.830 gouge Fluffy_Pillow 36.6/100: 37% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
1:44.835 saber_slash Fluffy_Pillow 85.6/100: 86% energy | 2.0/6: 33% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
1:45.639 run_through Fluffy_Pillow 78.0/100: 78% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
1:46.444 saber_slash Fluffy_Pillow 81.4/100: 81% energy | 2.0/6: 33% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, potion_of_the_old_war
1:47.249 ghostly_strike Fluffy_Pillow 57.8/100: 58% energy | 4.0/6: 67% combo_points adrenaline_rush, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, potion_of_the_old_war
1:48.053 pistol_shot Fluffy_Pillow 54.2/100: 54% energy | 5.0/6: 83% combo_points raid_movement, adrenaline_rush, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, potion_of_the_old_war
1:48.860 Waiting 0.200 sec 80.7/100: 81% energy | 6.0/6: 100% combo_points raid_movement, adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, potion_of_the_old_war
1:49.060 run_through Fluffy_Pillow 87.2/100: 87% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, potion_of_the_old_war
1:49.865 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, potion_of_the_old_war
1:50.670 blade_flurry Fluffy_Pillow 76.4/100: 76% energy | 2.0/6: 33% combo_points raid_movement, adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, potion_of_the_old_war
1:50.670 Waiting 2.500 sec 76.4/100: 76% energy | 2.0/6: 33% combo_points raid_movement, blade_flurry, adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, potion_of_the_old_war
1:53.170 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points blade_flurry, adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, potion_of_the_old_war
1:53.974 saber_slash Fluffy_Pillow 90.5/100: 91% energy | 4.0/6: 67% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, potion_of_the_old_war
1:54.777 pistol_shot Fluffy_Pillow 53.2/100: 53% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, potion_of_the_old_war
1:55.782 run_through Fluffy_Pillow 68.6/100: 69% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, potion_of_the_old_war
1:56.786 saber_slash Fluffy_Pillow 76.9/100: 77% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, potion_of_the_old_war
1:57.790 gouge Fluffy_Pillow 42.2/100: 42% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, potion_of_the_old_war
1:58.794 ghostly_strike Fluffy_Pillow 57.5/100: 58% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, potion_of_the_old_war
1:59.798 Waiting 0.500 sec 42.8/100: 43% energy | 4.0/6: 67% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, potion_of_the_old_war
2:00.298 saber_slash Fluffy_Pillow 50.5/100: 50% energy | 4.0/6: 67% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, potion_of_the_old_war
2:01.304 Waiting 1.200 sec 31.8/100: 32% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, potion_of_the_old_war
2:02.504 saber_slash Fluffy_Pillow 50.1/100: 50% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, potion_of_the_old_war
2:03.507 Waiting 1.527 sec 15.4/100: 15% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, potion_of_the_old_war
2:05.034 run_through Fluffy_Pillow 54.7/100: 55% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
2:06.040 marked_for_death Fluffy_Pillow_Add1 48.3/100: 48% energy | 2.0/6: 33% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
2:06.040 run_through Fluffy_Pillow 48.3/100: 48% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
2:07.044 pistol_shot Fluffy_Pillow 41.8/100: 42% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
2:08.048 saber_slash Fluffy_Pillow 58.4/100: 58% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
2:09.053 gouge Fluffy_Pillow 24.9/100: 25% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
2:10.057 cancel_buff Fluffy_Pillow 73.5/100: 73% energy | 4.0/6: 67% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
2:10.057 vanish Fluffy_Pillow 73.5/100: 73% energy | 4.0/6: 67% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
2:10.057 ambush Fluffy_Pillow 73.5/100: 73% energy | 4.0/6: 67% combo_points vanish, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
2:11.063 run_through Fluffy_Pillow 31.3/100: 31% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, hidden_blade, blood_frenzy
2:12.069 Waiting 0.500 sec 42.1/100: 42% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, hidden_blade, blood_frenzy
2:12.569 saber_slash Fluffy_Pillow 51.0/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, hidden_blade, blood_frenzy
2:13.573 pistol_shot Fluffy_Pillow 18.8/100: 19% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
2:14.581 ghostly_strike Fluffy_Pillow 36.6/100: 37% energy | 4.0/6: 67% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
2:15.587 Waiting 1.000 sec 24.4/100: 24% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
2:16.587 saber_slash Fluffy_Pillow 58.2/100: 58% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
2:17.591 run_through Fluffy_Pillow 41.9/100: 42% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
2:18.596 Waiting 0.300 sec 36.7/100: 37% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
2:18.896 gouge Fluffy_Pillow 42.1/100: 42% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
2:20.057 blade_flurry Fluffy_Pillow 78.6/100: 79% energy | 2.0/6: 33% combo_points raid_movement, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
2:20.057 Waiting 0.500 sec 78.6/100: 79% energy | 2.0/6: 33% combo_points raid_movement, blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
2:20.557 saber_slash Fluffy_Pillow 86.9/100: 87% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
2:21.560 saber_slash Fluffy_Pillow 69.4/100: 69% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
2:22.564 pistol_shot Fluffy_Pillow 51.9/100: 52% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
2:23.571 run_through Fluffy_Pillow 84.5/100: 85% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
2:24.576 saber_slash Fluffy_Pillow 94.1/100: 94% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
2:25.579 saber_slash Fluffy_Pillow 60.6/100: 61% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
2:26.583 Waiting 0.500 sec 43.1/100: 43% energy | 4.0/6: 67% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
2:27.083 saber_slash Fluffy_Pillow 67.4/100: 67% energy | 4.0/6: 67% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
2:28.087 ghostly_strike Fluffy_Pillow 33.3/100: 33% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
2:29.091 roll_the_bones Fluffy_Pillow 18.6/100: 19% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
2:30.097 gouge Fluffy_Pillow 40.8/100: 41% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), jolly_roger, buried_treasure, roll_the_bones
2:31.100 saber_slash Fluffy_Pillow 59.9/100: 60% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), jolly_roger, buried_treasure, roll_the_bones
2:32.104 pistol_shot Fluffy_Pillow 45.1/100: 45% energy | 4.0/6: 67% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, buried_treasure, roll_the_bones
2:33.109 run_through Fluffy_Pillow 80.3/100: 80% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), jolly_roger, buried_treasure, roll_the_bones
2:34.111 saber_slash Fluffy_Pillow 92.4/100: 92% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), jolly_roger, buried_treasure, roll_the_bones
2:35.117 saber_slash Fluffy_Pillow 62.6/100: 63% energy | 3.0/6: 50% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, buried_treasure, roll_the_bones, blood_frenzy
2:36.122 pistol_shot Fluffy_Pillow 33.3/100: 33% energy | 5.0/6: 83% combo_points raid_movement, blade_flurry, opportunity, alacrity(20), jolly_roger, buried_treasure, roll_the_bones, blood_frenzy
2:37.126 run_through Fluffy_Pillow 69.9/100: 70% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), jolly_roger, buried_treasure, roll_the_bones, blood_frenzy
2:38.131 marked_for_death Fluffy_Pillow_Add1 67.6/100: 68% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), jolly_roger, buried_treasure, roll_the_bones, blood_frenzy
2:38.131 run_through Fluffy_Pillow 67.6/100: 68% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), jolly_roger, buried_treasure, roll_the_bones, blood_frenzy
2:39.135 saber_slash Fluffy_Pillow 65.3/100: 65% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), jolly_roger, buried_treasure, roll_the_bones, blood_frenzy
2:40.139 cancel_buff Fluffy_Pillow 36.0/100: 36% energy | 3.0/6: 50% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, buried_treasure, roll_the_bones, blood_frenzy
2:40.139 pistol_shot Fluffy_Pillow 36.0/100: 36% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, buried_treasure, roll_the_bones, blood_frenzy
2:41.141 saber_slash Fluffy_Pillow 58.2/100: 58% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, buried_treasure, roll_the_bones, blood_frenzy
2:42.146 sprint Fluffy_Pillow 30.4/100: 30% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), jolly_roger, buried_treasure, roll_the_bones, blood_frenzy
2:42.146 run_through Fluffy_Pillow 30.4/100: 30% energy | 6.0/6: 100% combo_points opportunity, sprint, alacrity(20), jolly_roger, buried_treasure, roll_the_bones, blood_frenzy
2:43.151 pistol_shot Fluffy_Pillow 29.7/100: 30% energy | 1.0/6: 17% combo_points opportunity, sprint, alacrity(20), jolly_roger, buried_treasure, roll_the_bones, blood_frenzy
2:44.156 saber_slash Fluffy_Pillow 51.9/100: 52% energy | 2.0/6: 33% combo_points sprint, alacrity(20), jolly_roger, buried_treasure, roll_the_bones, blood_frenzy
2:45.160 ghostly_strike Fluffy_Pillow 39.0/100: 39% energy | 4.0/6: 67% combo_points opportunity, sprint, alacrity(20), jolly_roger, buried_treasure, roll_the_bones
2:46.163 pistol_shot Fluffy_Pillow 45.6/100: 46% energy | 5.0/6: 83% combo_points opportunity, sprint, alacrity(20), jolly_roger, buried_treasure, roll_the_bones
2:47.168 run_through Fluffy_Pillow 66.2/100: 66% energy | 6.0/6: 100% combo_points sprint, alacrity(20), jolly_roger, buried_treasure, roll_the_bones
2:48.173 saber_slash Fluffy_Pillow 63.8/100: 64% energy | 1.0/6: 17% combo_points sprint, alacrity(20), jolly_roger, buried_treasure, roll_the_bones
2:49.177 pistol_shot Fluffy_Pillow 34.4/100: 34% energy | 3.0/6: 50% combo_points opportunity, sprint, alacrity(20), jolly_roger, buried_treasure, roll_the_bones
2:50.181 blade_flurry Fluffy_Pillow 71.0/100: 71% energy | 4.0/6: 67% combo_points raid_movement, alacrity(20), jolly_roger, buried_treasure, roll_the_bones
2:50.181 Waiting 2.400 sec 71.0/100: 71% energy | 4.0/6: 67% combo_points raid_movement, blade_flurry, alacrity(20), jolly_roger, buried_treasure, roll_the_bones
2:52.581 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 4.0/6: 67% combo_points blade_flurry, alacrity(20), jolly_roger, buried_treasure, roll_the_bones
2:53.586 run_through Fluffy_Pillow 69.2/100: 69% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, buried_treasure, roll_the_bones
2:54.591 saber_slash Fluffy_Pillow 65.3/100: 65% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, buried_treasure, roll_the_bones
2:55.596 pistol_shot Fluffy_Pillow 34.5/100: 34% energy | 2.0/6: 33% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, buried_treasure, roll_the_bones
2:56.600 saber_slash Fluffy_Pillow 53.6/100: 54% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), jolly_roger, buried_treasure, roll_the_bones
2:57.603 pistol_shot Fluffy_Pillow 22.8/100: 23% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, buried_treasure, roll_the_bones
2:58.606 run_through Fluffy_Pillow 41.9/100: 42% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), jolly_roger, buried_treasure, roll_the_bones
2:59.612 gouge Fluffy_Pillow 38.1/100: 38% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), jolly_roger, buried_treasure, roll_the_bones
3:00.616 saber_slash Fluffy_Pillow 57.2/100: 57% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), jolly_roger, buried_treasure, roll_the_bones
3:01.622 ghostly_strike Fluffy_Pillow 42.4/100: 42% energy | 4.0/6: 67% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, buried_treasure, roll_the_bones
3:02.625 pistol_shot Fluffy_Pillow 31.5/100: 32% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, buried_treasure, roll_the_bones
3:03.632 run_through Fluffy_Pillow 68.3/100: 68% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), jolly_roger, buried_treasure, roll_the_bones, blood_frenzy
3:04.636 curse_of_the_dreadblades Fluffy_Pillow 82.0/100: 82% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), jolly_roger, buried_treasure, roll_the_bones, blood_frenzy
3:04.636 saber_slash Fluffy_Pillow 82.0/100: 82% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), jolly_roger, buried_treasure, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
3:05.641 run_through Fluffy_Pillow 52.7/100: 53% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), jolly_roger, buried_treasure, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
3:06.647 marked_for_death Fluffy_Pillow_Add1 66.4/100: 66% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), jolly_roger, buried_treasure, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
3:06.647 run_through Fluffy_Pillow 66.4/100: 66% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), jolly_roger, buried_treasure, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
3:07.650 saber_slash Fluffy_Pillow 64.0/100: 64% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), jolly_roger, buried_treasure, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
3:08.654 Waiting 0.400 sec 34.7/100: 35% energy | 6.0/6: 100% combo_points raid_movement, blade_flurry, alacrity(20), jolly_roger, buried_treasure, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
3:09.054 run_through Fluffy_Pillow 42.9/100: 43% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), jolly_roger, buried_treasure, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
3:10.059 cancel_buff Fluffy_Pillow 40.6/100: 41% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), jolly_roger, buried_treasure, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
3:10.059 gouge Fluffy_Pillow 40.6/100: 41% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, buried_treasure, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
3:11.063 saber_slash Fluffy_Pillow 62.9/100: 63% energy | 3.0/6: 50% combo_points alacrity(20), jolly_roger, buried_treasure, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
3:12.067 roll_the_bones Fluffy_Pillow 51.1/100: 51% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), jolly_roger, buried_treasure, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
3:13.072 pistol_shot Fluffy_Pillow 55.9/100: 56% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), jolly_roger, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
3:14.076 roll_the_bones Fluffy_Pillow 89.7/100: 90% energy | 6.0/6: 100% combo_points alacrity(20), jolly_roger, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
3:15.080 saber_slash Fluffy_Pillow 94.5/100: 94% energy | 1.0/6: 17% combo_points alacrity(20), broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
3:16.084 roll_the_bones Fluffy_Pillow 78.3/100: 78% energy | 6.0/6: 100% combo_points alacrity(20), broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
3:17.088 saber_slash Fluffy_Pillow 99.0/100: 99% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
3:18.094 ghostly_strike Fluffy_Pillow 82.9/100: 83% energy | 3.0/6: 50% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
3:19.098 saber_slash Fluffy_Pillow 70.7/100: 71% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
3:20.103 blade_flurry Fluffy_Pillow 38.5/100: 38% energy | 5.0/6: 83% combo_points raid_movement, alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
3:20.103 Waiting 3.100 sec 38.5/100: 38% energy | 5.0/6: 83% combo_points raid_movement, blade_flurry, alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
3:23.203 run_through Fluffy_Pillow 86.6/100: 87% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, roll_the_bones
3:24.208 Waiting 0.800 sec 95.0/100: 95% energy | 1.0/6: 17% combo_points raid_movement, blade_flurry, alacrity(20), jolly_roger, grand_melee, roll_the_bones
3:25.008 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, roll_the_bones
3:26.012 saber_slash Fluffy_Pillow 97.3/100: 97% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, roll_the_bones
3:27.016 saber_slash Fluffy_Pillow 62.6/100: 63% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, roll_the_bones
3:28.020 pistol_shot Fluffy_Pillow 28.0/100: 28% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones
3:29.024 run_through Fluffy_Pillow 43.3/100: 43% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, roll_the_bones
3:30.028 saber_slash Fluffy_Pillow 51.6/100: 52% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, roll_the_bones
3:31.032 ghostly_strike Fluffy_Pillow 32.9/100: 33% energy | 4.0/6: 67% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones
3:32.035 pistol_shot Fluffy_Pillow 50.2/100: 50% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones
3:33.039 run_through Fluffy_Pillow 65.5/100: 66% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, roll_the_bones
3:34.043 saber_slash Fluffy_Pillow 73.8/100: 74% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, roll_the_bones
3:35.048 saber_slash Fluffy_Pillow 87.2/100: 87% energy | 4.0/6: 67% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones
3:36.051 run_through Fluffy_Pillow 68.5/100: 68% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones
3:37.055 marked_for_death Fluffy_Pillow_Add1 60.8/100: 61% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones
3:37.055 run_through Fluffy_Pillow 60.8/100: 61% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones
3:38.060 pistol_shot Fluffy_Pillow 53.1/100: 53% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones
3:39.064 saber_slash Fluffy_Pillow 84.4/100: 84% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, roll_the_bones
3:40.069 cancel_buff Fluffy_Pillow 65.8/100: 66% energy | 4.0/6: 67% combo_points raid_movement, blade_flurry, opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones
3:40.069 pistol_shot Fluffy_Pillow 65.8/100: 66% energy | 4.0/6: 67% combo_points raid_movement, opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones
3:41.074 run_through Fluffy_Pillow 98.3/100: 98% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones
3:42.078 saber_slash Fluffy_Pillow 91.7/100: 92% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones
3:43.080 saber_slash Fluffy_Pillow 74.8/100: 75% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
3:44.085 ghostly_strike Fluffy_Pillow 42.6/100: 43% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
3:45.089 pistol_shot Fluffy_Pillow 46.4/100: 46% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
3:46.094 run_through Fluffy_Pillow 64.2/100: 64% energy | 6.0/6: 100% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
3:47.100 saber_slash Fluffy_Pillow 59.0/100: 59% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
3:48.104 gouge Fluffy_Pillow 26.8/100: 27% energy | 3.0/6: 50% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
3:49.109 Waiting 0.400 sec 44.6/100: 45% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
3:49.509 saber_slash Fluffy_Pillow 51.7/100: 52% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
3:50.513 blade_flurry Fluffy_Pillow 19.5/100: 19% energy | 6.0/6: 100% combo_points raid_movement, opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
3:50.513 Waiting 2.635 sec 19.5/100: 19% energy | 6.0/6: 100% combo_points raid_movement, blade_flurry, opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
3:53.148 run_through Fluffy_Pillow 94.9/100: 95% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
3:54.152 saber_slash Fluffy_Pillow 88.4/100: 88% energy | 2.0/6: 33% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
3:55.157 pistol_shot Fluffy_Pillow 55.0/100: 55% energy | 4.0/6: 67% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
3:56.161 Waiting 0.900 sec 87.5/100: 88% energy | 5.0/6: 83% combo_points raid_movement, blade_flurry, alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
3:57.061 run_through Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
3:58.065 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
3:59.071 saber_slash Fluffy_Pillow 66.6/100: 67% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
4:00.075 ghostly_strike Fluffy_Pillow 49.1/100: 49% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
4:01.082 gouge Fluffy_Pillow 35.7/100: 36% energy | 4.0/6: 67% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
4:02.087 run_through Fluffy_Pillow 67.9/100: 68% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, roll_the_bones
4:03.092 saber_slash Fluffy_Pillow 60.2/100: 60% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, roll_the_bones
4:04.097 pistol_shot Fluffy_Pillow 41.5/100: 42% energy | 3.0/6: 50% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones
4:05.103 saber_slash Fluffy_Pillow 56.9/100: 57% energy | 4.0/6: 67% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, roll_the_bones
4:06.108 Waiting 0.182 sec 22.2/100: 22% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, roll_the_bones
4:06.290 run_through Fluffy_Pillow 25.0/100: 25% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, roll_the_bones
4:07.296 marked_for_death Fluffy_Pillow_Add1 33.3/100: 33% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, roll_the_bones
4:07.296 run_through Fluffy_Pillow 33.3/100: 33% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, roll_the_bones
4:08.302 Waiting 0.600 sec 41.7/100: 42% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, roll_the_bones
4:08.902 saber_slash Fluffy_Pillow 50.8/100: 51% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, roll_the_bones
4:09.907 Waiting 0.578 sec 16.2/100: 16% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, roll_the_bones
4:10.485 cancel_buff Fluffy_Pillow 25.0/100: 25% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), jolly_roger, grand_melee, roll_the_bones
4:10.485 Waiting 0.400 sec 25.0/100: 25% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones
4:10.885 gouge Fluffy_Pillow 31.6/100: 32% energy | 2.0/6: 33% combo_points alacrity(20)
4:12.087 vanish Fluffy_Pillow 68.0/100: 68% energy | 3.0/6: 50% combo_points raid_movement, alacrity(20), blood_frenzy
4:12.087 Waiting 1.000 sec 68.0/100: 68% energy | 3.0/6: 50% combo_points raid_movement, vanish, alacrity(20), blood_frenzy
4:13.087 ambush Fluffy_Pillow 85.7/100: 86% energy | 3.0/6: 50% combo_points vanish, alacrity(20), blood_frenzy
4:14.092 roll_the_bones Fluffy_Pillow 59.5/100: 60% energy | 5.0/6: 83% combo_points alacrity(20), hidden_blade, blood_frenzy
4:15.095 ghostly_strike Fluffy_Pillow 64.3/100: 64% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, roll_the_bones, hidden_blade, blood_frenzy
4:16.101 saber_slash Fluffy_Pillow 52.1/100: 52% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, roll_the_bones, hidden_blade, blood_frenzy
4:17.105 Waiting 0.400 sec 35.9/100: 36% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, roll_the_bones, blood_frenzy
4:17.505 saber_slash Fluffy_Pillow 59.0/100: 59% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, roll_the_bones, blood_frenzy
4:18.510 roll_the_bones Fluffy_Pillow 42.8/100: 43% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), jolly_roger, roll_the_bones, blood_frenzy
4:19.516 pistol_shot Fluffy_Pillow 63.6/100: 64% energy | 2.0/6: 33% combo_points opportunity, alacrity(20), jolly_roger, roll_the_bones, blood_frenzy
4:20.521 blade_flurry Fluffy_Pillow 81.4/100: 81% energy | 3.0/6: 50% combo_points raid_movement, alacrity(20), jolly_roger, roll_the_bones, blood_frenzy
4:20.521 Waiting 2.600 sec 81.4/100: 81% energy | 3.0/6: 50% combo_points raid_movement, blade_flurry, alacrity(20), jolly_roger, roll_the_bones, blood_frenzy
4:23.121 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), jolly_roger, roll_the_bones
4:24.124 roll_the_bones Fluffy_Pillow 65.3/100: 65% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, roll_the_bones
4:25.129 saber_slash Fluffy_Pillow 87.5/100: 87% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), buried_treasure, roll_the_bones
4:26.134 saber_slash Fluffy_Pillow 88.6/100: 89% energy | 2.0/6: 33% combo_points blade_flurry, opportunity, alacrity(20), buried_treasure, roll_the_bones
4:27.138 pistol_shot Fluffy_Pillow 57.8/100: 58% energy | 4.0/6: 67% combo_points blade_flurry, opportunity, alacrity(20), buried_treasure, roll_the_bones
4:28.144 roll_the_bones Fluffy_Pillow 77.0/100: 77% energy | 5.0/6: 83% combo_points raid_movement, blade_flurry, alacrity(20), buried_treasure, roll_the_bones
4:29.148 saber_slash Fluffy_Pillow 79.3/100: 79% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
4:30.151 gouge Fluffy_Pillow 44.6/100: 45% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
4:31.155 ghostly_strike Fluffy_Pillow 75.9/100: 76% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
4:32.159 saber_slash Fluffy_Pillow 61.2/100: 61% energy | 4.0/6: 67% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
4:33.164 run_through Fluffy_Pillow 42.6/100: 43% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
4:34.170 pistol_shot Fluffy_Pillow 50.9/100: 51% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
4:35.175 curse_of_the_dreadblades Fluffy_Pillow 82.2/100: 82% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
4:35.175 saber_slash Fluffy_Pillow 82.2/100: 82% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
4:36.180 run_through Fluffy_Pillow 63.6/100: 64% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
4:37.185 marked_for_death Fluffy_Pillow_Add1 55.9/100: 56% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
4:37.185 run_through Fluffy_Pillow 55.9/100: 56% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
4:38.191 saber_slash Fluffy_Pillow 64.2/100: 64% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
4:39.196 adrenaline_rush Fluffy_Pillow 45.6/100: 46% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
4:39.196 run_through Fluffy_Pillow 45.6/100: 46% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
4:40.000 cancel_buff Fluffy_Pillow 63.1/100: 63% energy | 2.0/6: 33% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
4:40.000 pistol_shot Fluffy_Pillow 63.1/100: 63% energy | 2.0/6: 33% combo_points adrenaline_rush, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
4:40.806 run_through Fluffy_Pillow 89.6/100: 90% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
4:41.611 saber_slash Fluffy_Pillow 93.0/100: 93% energy | 2.0/6: 33% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
4:42.415 sprint Fluffy_Pillow 85.3/100: 85% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
4:42.415 run_through Fluffy_Pillow 85.3/100: 85% energy | 6.0/6: 100% combo_points adrenaline_rush, sprint, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
4:43.222 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, sprint, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
4:44.028 Waiting 0.600 sec 76.4/100: 76% energy | 6.0/6: 100% combo_points raid_movement, adrenaline_rush, opportunity, sprint, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
4:44.628 run_through Fluffy_Pillow 96.1/100: 96% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades
4:45.432 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:46.236 run_through Fluffy_Pillow 94.5/100: 94% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:47.039 saber_slash Fluffy_Pillow 99.9/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
4:47.842 run_through Fluffy_Pillow 78.4/100: 78% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
4:48.646 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
4:49.451 ghostly_strike Fluffy_Pillow 78.5/100: 79% energy | 3.0/6: 50% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
4:50.256 blade_flurry Fluffy_Pillow 77.0/100: 77% energy | 4.0/6: 67% combo_points raid_movement, adrenaline_rush, opportunity, sprint, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
4:50.256 Waiting 2.700 sec 77.0/100: 77% energy | 4.0/6: 67% combo_points raid_movement, blade_flurry, adrenaline_rush, opportunity, sprint, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
4:52.956 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 4.0/6: 67% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
4:53.760 saber_slash Fluffy_Pillow 92.5/100: 92% energy | 5.0/6: 83% combo_points blade_flurry, adrenaline_rush, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
4:54.564 run_through Fluffy_Pillow 94.9/100: 95% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
4:55.570 saber_slash Fluffy_Pillow 88.5/100: 88% energy | 2.0/6: 33% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
4:56.574 pistol_shot Fluffy_Pillow 55.0/100: 55% energy | 3.0/6: 50% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
4:57.577 saber_slash Fluffy_Pillow 71.6/100: 72% energy | 4.0/6: 67% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
4:58.583 run_through Fluffy_Pillow 54.1/100: 54% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
4:59.588 pistol_shot Fluffy_Pillow 63.7/100: 64% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
5:00.592 Waiting 0.500 sec 80.2/100: 80% energy | 2.0/6: 33% combo_points raid_movement, blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
5:01.092 saber_slash Fluffy_Pillow 88.5/100: 88% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
5:02.097 ghostly_strike Fluffy_Pillow 87.0/100: 87% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
5:03.101 saber_slash Fluffy_Pillow 73.6/100: 74% energy | 4.0/6: 67% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones, blood_frenzy
5:04.105 gouge Fluffy_Pillow 39.3/100: 39% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
5:05.110 run_through Fluffy_Pillow 54.6/100: 55% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
5:06.117 marked_for_death Fluffy_Pillow_Add1 47.0/100: 47% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
5:06.117 run_through Fluffy_Pillow 47.0/100: 47% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
5:07.121 Waiting 0.800 sec 39.3/100: 39% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
5:07.921 saber_slash Fluffy_Pillow 51.5/100: 52% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
5:08.926 Waiting 0.300 sec 32.9/100: 33% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
5:09.226 saber_slash Fluffy_Pillow 53.4/100: 53% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
5:10.230 cancel_buff Fluffy_Pillow 18.7/100: 19% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
5:10.230 Waiting 1.981 sec 18.7/100: 19% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
5:12.211 saber_slash Fluffy_Pillow 51.2/100: 51% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
5:13.215 pistol_shot Fluffy_Pillow 17.7/100: 18% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
5:14.221 roll_the_bones Fluffy_Pillow 50.2/100: 50% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, shark_infested_waters, roll_the_bones
5:15.227 saber_slash Fluffy_Pillow 69.7/100: 70% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, roll_the_bones
5:16.229 Waiting 0.800 sec 36.2/100: 36% energy | 2.0/6: 33% combo_points raid_movement, alacrity(20), true_bearing, roll_the_bones
5:17.029 gouge Fluffy_Pillow 49.3/100: 49% energy | 2.0/6: 33% combo_points alacrity(20), true_bearing, roll_the_bones
5:18.033 ghostly_strike Fluffy_Pillow 81.8/100: 82% energy | 3.0/6: 50% combo_points alacrity(20), true_bearing, roll_the_bones
5:19.038 saber_slash Fluffy_Pillow 68.2/100: 68% energy | 4.0/6: 67% combo_points alacrity(20), true_bearing, roll_the_bones
5:20.043 run_through Fluffy_Pillow 34.7/100: 35% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones
5:21.047 pistol_shot Fluffy_Pillow 28.2/100: 28% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones
5:22.053 saber_slash Fluffy_Pillow 60.7/100: 61% energy | 2.0/6: 33% combo_points alacrity(20), true_bearing, roll_the_bones
5:23.058 Waiting 0.700 sec 27.2/100: 27% energy | 3.0/6: 50% combo_points alacrity(20), true_bearing, roll_the_bones
5:23.758 saber_slash Fluffy_Pillow 54.7/100: 55% energy | 3.0/6: 50% combo_points alacrity(20), true_bearing, roll_the_bones
5:24.763 pistol_shot Fluffy_Pillow 37.2/100: 37% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones
5:25.768 run_through Fluffy_Pillow 69.6/100: 70% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, roll_the_bones
5:26.773 saber_slash Fluffy_Pillow 63.1/100: 63% energy | 2.0/6: 33% combo_points alacrity(20), true_bearing, roll_the_bones
5:27.778 gouge Fluffy_Pillow 29.6/100: 30% energy | 3.0/6: 50% combo_points alacrity(20), true_bearing, roll_the_bones
5:28.781 Waiting 0.300 sec 46.1/100: 46% energy | 4.0/6: 67% combo_points alacrity(20), true_bearing, roll_the_bones
5:29.081 saber_slash Fluffy_Pillow 51.0/100: 51% energy | 4.0/6: 67% combo_points alacrity(20), true_bearing, roll_the_bones
5:30.084 ghostly_strike Fluffy_Pillow 33.4/100: 33% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, roll_the_bones
5:31.088 Waiting 0.310 sec 19.9/100: 20% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, roll_the_bones
5:31.398 run_through Fluffy_Pillow 25.0/100: 25% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, roll_the_bones
5:32.403 Waiting 1.997 sec 18.5/100: 18% energy | 1.0/6: 17% combo_points raid_movement, alacrity(20), true_bearing, roll_the_bones
5:34.400 saber_slash Fluffy_Pillow 51.2/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, roll_the_bones
5:35.403 pistol_shot Fluffy_Pillow 19.0/100: 19% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:36.407 saber_slash Fluffy_Pillow 52.8/100: 53% energy | 4.0/6: 67% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:37.413 Waiting 0.200 sec 36.6/100: 37% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:37.613 gouge Fluffy_Pillow 40.2/100: 40% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:38.782 run_through Fluffy_Pillow 60.9/100: 61% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:39.787 saber_slash Fluffy_Pillow 55.7/100: 56% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:40.790 Waiting 0.600 sec 39.4/100: 39% energy | 2.0/6: 33% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:41.390 saber_slash Fluffy_Pillow 50.1/100: 50% energy | 2.0/6: 33% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:42.393 Waiting 1.000 sec 33.8/100: 34% energy | 3.0/6: 50% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:43.393 saber_slash Fluffy_Pillow 51.6/100: 52% energy | 3.0/6: 50% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:44.396 pistol_shot Fluffy_Pillow 35.3/100: 35% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:45.401 sprint Fluffy_Pillow 53.1/100: 53% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:45.401 run_through Fluffy_Pillow 53.1/100: 53% energy | 6.0/6: 100% combo_points sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:46.405 vanish Fluffy_Pillow 63.9/100: 64% energy | 1.0/6: 17% combo_points sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:46.405 ambush Fluffy_Pillow 63.9/100: 64% energy | 1.0/6: 17% combo_points vanish, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:47.410 ghostly_strike Fluffy_Pillow 37.7/100: 38% energy | 3.0/6: 50% combo_points sprint, alacrity(20), true_bearing, roll_the_bones, hidden_blade, blood_frenzy
5:48.415 Waiting 0.300 sec 25.5/100: 26% energy | 4.0/6: 67% combo_points raid_movement, sprint, alacrity(20), true_bearing, roll_the_bones, hidden_blade, blood_frenzy
5:48.715 gouge Fluffy_Pillow 30.8/100: 31% energy | 4.0/6: 67% combo_points sprint, alacrity(20), true_bearing, roll_the_bones, hidden_blade, blood_frenzy
5:49.719 saber_slash Fluffy_Pillow 64.6/100: 65% energy | 5.0/6: 83% combo_points sprint, alacrity(20), true_bearing, roll_the_bones, hidden_blade, blood_frenzy
5:50.724 run_through Fluffy_Pillow 64.4/100: 64% energy | 6.0/6: 100% combo_points sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:51.728 saber_slash Fluffy_Pillow 59.2/100: 59% energy | 2.0/6: 33% combo_points sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:52.733 pistol_shot Fluffy_Pillow 27.0/100: 27% energy | 4.0/6: 67% combo_points opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
5:53.736 Waiting 0.400 sec 44.1/100: 44% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, roll_the_bones
5:54.136 saber_slash Fluffy_Pillow 50.7/100: 51% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, roll_the_bones
5:55.140 roll_the_bones Fluffy_Pillow 17.1/100: 17% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones
5:56.144 pistol_shot Fluffy_Pillow 20.6/100: 21% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones
5:57.147 Waiting 0.800 sec 37.0/100: 37% energy | 2.0/6: 33% combo_points alacrity(20), true_bearing, roll_the_bones
5:57.947 saber_slash Fluffy_Pillow 66.2/100: 66% energy | 2.0/6: 33% combo_points alacrity(20), true_bearing, roll_the_bones
5:58.951 pistol_shot Fluffy_Pillow 48.6/100: 49% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones
5:59.955 ghostly_strike Fluffy_Pillow 81.1/100: 81% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, roll_the_bones
6:00.961 run_through Fluffy_Pillow 67.6/100: 68% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, roll_the_bones
6:01.966 adrenaline_rush Fluffy_Pillow 61.1/100: 61% energy | 2.0/6: 33% combo_points alacrity(20), true_bearing, roll_the_bones
6:01.966 saber_slash Fluffy_Pillow 61.1/100: 61% energy | 2.0/6: 33% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones
6:02.771 saber_slash Fluffy_Pillow 53.5/100: 54% energy | 3.0/6: 50% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones
6:03.573 gouge Fluffy_Pillow 29.8/100: 30% energy | 4.0/6: 67% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones
6:04.575 Waiting 0.500 sec 62.7/100: 63% energy | 5.0/6: 83% combo_points raid_movement, adrenaline_rush, alacrity(20), true_bearing, roll_the_bones
6:05.075 saber_slash Fluffy_Pillow 79.1/100: 79% energy | 5.0/6: 83% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones
6:05.880 run_through Fluffy_Pillow 57.6/100: 58% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
6:06.684 curse_of_the_dreadblades Fluffy_Pillow 63.1/100: 63% energy | 2.0/6: 33% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
6:06.684 saber_slash Fluffy_Pillow 63.1/100: 63% energy | 2.0/6: 33% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:07.488 run_through Fluffy_Pillow 57.6/100: 58% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:08.293 pistol_shot Fluffy_Pillow 63.1/100: 63% energy | 2.0/6: 33% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:09.098 run_through Fluffy_Pillow 91.6/100: 92% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:09.902 saber_slash Fluffy_Pillow 97.1/100: 97% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:10.706 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:11.509 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:12.311 sprint Fluffy_Pillow 94.4/100: 94% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:12.311 run_through Fluffy_Pillow 94.4/100: 94% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:13.116 saber_slash Fluffy_Pillow 99.9/100: 100% energy | 2.0/6: 33% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:13.920 run_through Fluffy_Pillow 94.4/100: 94% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:14.724 saber_slash Fluffy_Pillow 99.9/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades, blood_frenzy
6:15.527 run_through Fluffy_Pillow 77.2/100: 77% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades
6:16.331 saber_slash Fluffy_Pillow 80.6/100: 81% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades
6:17.136 run_through Fluffy_Pillow 70.2/100: 70% energy | 6.0/6: 100% combo_points opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades
6:18.141 pistol_shot Fluffy_Pillow 63.7/100: 64% energy | 1.0/6: 17% combo_points opportunity, sprint, alacrity(20), true_bearing, roll_the_bones, curse_of_the_dreadblades
6:19.146 run_through Fluffy_Pillow 80.1/100: 80% energy | 6.0/6: 100% combo_points sprint, alacrity(20), true_bearing, roll_the_bones
6:20.151 vanish Fluffy_Pillow 89.6/100: 90% energy | 1.0/6: 17% combo_points raid_movement, sprint, alacrity(20), true_bearing, roll_the_bones
6:20.151 Waiting 0.700 sec 89.6/100: 90% energy | 1.0/6: 17% combo_points raid_movement, vanish, sprint, alacrity(20), true_bearing, roll_the_bones
6:20.851 ambush Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points vanish, alacrity(20), true_bearing, roll_the_bones
6:21.857 ghostly_strike Fluffy_Pillow 72.5/100: 73% energy | 3.0/6: 50% combo_points alacrity(20), true_bearing, roll_the_bones, hidden_blade
6:22.862 saber_slash Fluffy_Pillow 59.0/100: 59% energy | 4.0/6: 67% combo_points alacrity(20), true_bearing, roll_the_bones, hidden_blade
6:23.867 run_through Fluffy_Pillow 57.5/100: 57% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, roll_the_bones
6:24.871 saber_slash Fluffy_Pillow 50.9/100: 51% energy | 2.0/6: 33% combo_points alacrity(20), true_bearing, roll_the_bones
6:25.872 gouge Fluffy_Pillow 33.4/100: 33% energy | 3.0/6: 50% combo_points alacrity(20), true_bearing, roll_the_bones
6:26.878 Waiting 0.100 sec 49.9/100: 50% energy | 4.0/6: 67% combo_points alacrity(20), true_bearing, roll_the_bones
6:26.978 saber_slash Fluffy_Pillow 51.5/100: 52% energy | 4.0/6: 67% combo_points alacrity(20), true_bearing, roll_the_bones
6:27.983 Waiting 1.000 sec 34.0/100: 34% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, roll_the_bones
6:28.983 saber_slash Fluffy_Pillow 50.4/100: 50% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, roll_the_bones
6:29.988 run_through Fluffy_Pillow 32.9/100: 33% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, roll_the_bones
6:30.991 Waiting 0.400 sec 42.3/100: 42% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, roll_the_bones
6:31.391 saber_slash Fluffy_Pillow 64.9/100: 65% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, roll_the_bones
6:32.393 ghostly_strike Fluffy_Pillow 31.3/100: 31% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones
6:33.398 pistol_shot Fluffy_Pillow 33.8/100: 34% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones
6:34.402 saber_slash Fluffy_Pillow 50.3/100: 50% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, roll_the_bones
6:35.407 Waiting 0.426 sec 17.4/100: 17% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones, blood_frenzy
6:35.833 run_through Fluffy_Pillow 25.0/100: 25% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), true_bearing, roll_the_bones, blood_frenzy

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8805 8480 0
Agility 25492 23786 13626 (8132)
Stamina 31123 31123 19786
Intellect 5323 4998 0
Spirit 5 5 0
Health 1867380 1867380 0
Energy 100 100 0
Combo Points 6 6 0
Crit 28.80% 28.80% 4831
Haste 13.92% 13.92% 4524
Damage / Heal Versatility 4.80% 3.86% 1546
Attack Power 38238 35679 0
Mastery 56.72% 56.72% 6223
Armor 2045 2045 2045
Run Speed 8 0 0
Leech 3.42% 3.42% 786

Gear

Source Slot Average Item Level: 855.00
Local Head Magic-Warped Hood
ilevel: 860, stats: { 276 Armor, +2136 Sta, +1424 AgiInt, +939 Mastery, +416 Crit }
Local Neck Brysngamen, Torc of Helheim
ilevel: 845, stats: { +1045 Sta, +1287 Mastery, +514 Vers }, gems: { +150 Vers }
Local Shoulders Biornskin Shoulderpads
ilevel: 830, stats: { 231 Armor, +807 AgiInt, +1211 Sta, +532 Crit, +376 Mastery, +389 Leech }
Local Shirt Rich Purple Silk Shirt
ilevel: 1
Local Chest Scarred Ragefang Chestpiece
ilevel: 850, stats: { 329 Armor, +1945 Sta, +1297 AgiInt, +820 Mastery, +484 Haste }
Local Waist Forest-Lord's Waistwrap
ilevel: 850, stats: { 185 Armor, +1459 Sta, +973 AgiInt, +637 Haste, +342 Mastery }
Local Legs Splotched Bloodfur Leggings
ilevel: 850, stats: { 288 Armor, +1945 Sta, +1297 AgiInt, +932 Crit, +372 Mastery }
Local Feet Thraxi's Tricksy Treads
ilevel: 895, stats: { 263 Armor, +2219 Sta, +1479 Agi, +745 Crit, +413 Mastery }
Local Wrists Biornskin Bracer
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +479 Crit, +227 Mastery }
Local Hands Dreamsculptor's Gloves
ilevel: 850, stats: { 206 Armor, +1459 Sta, +973 AgiInt, +615 Haste, +363 Crit }
Local Finger1 Dreadful Cyclopean Signet
ilevel: 850, stats: { +1094 Sta, +997 Haste, +839 Mastery }
Local Finger2 Band of Fused Coral
ilevel: 845, stats: { +1045 Sta, +1287 Haste, +514 Crit }
Local Trinket1 An'she's Token of Guile
ilevel: 835, stats: { +1073 Agi, +397 Leech, +882 Vers }
Local Trinket2 Bloodthirsty Instinct
ilevel: 870, stats: { +1486 Agi }
Local Back Goldscar Pelt
ilevel: 845, stats: { 128 Armor, +696 StrAgiInt, +1045 Sta, +216 Crit, +504 Haste }
Local Main Hand The Dreadblades
ilevel: 879, weapon: { 4318 - 8020, 2.6 }, stats: { +728 Agi, +1093 Sta, +317 Crit, +304 Mastery }, relics: { +43 ilevels, +43 ilevels, +43 ilevels }
Local Off Hand The Dreadblades
ilevel: 879, weapon: { 4318 - 8020, 2.6 }, stats: { +728 Agi, +1093 Sta, +317 Crit, +304 Mastery }

Talents

Level
15 Ghostly Strike (Outlaw Rogue) Swordmaster (Outlaw Rogue) Quick Draw (Outlaw Rogue)
30 Grappling Hook (Outlaw Rogue) Acrobatic Strikes (Outlaw Rogue) Hit and Run (Outlaw Rogue)
45 Deeper Stratagem Anticipation Vigor
60 Iron Stomach (Outlaw Rogue) Elusiveness Cheat Death
75 Parley (Outlaw Rogue) Prey on the Weak Dirty Tricks (Outlaw Rogue)
90 Cannonball Barrage (Outlaw Rogue) Alacrity Killing Spree (Outlaw Rogue)
100 Slice and Dice (Outlaw Rogue) Marked for Death Death from Above

Profile

rogue="Vait"
origin="https://us.api.battle.net/wow/character/thrall/Vait/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/196/133742276-avatar.jpg"
level=110
race=undead
role=attack
position=back
professions=skinning=800/herbalism=114
talents=1113322
artifact=44:0:0:0:0:1052:1:1054:1:1056:1:1057:1:1060:3:1061:3:1063:3:1064:3:1065:1:1066:3:1348:1
spec=outlaw

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=flask_of_the_seventh_demon
actions.precombat+=/augmentation,name=defiled
actions.precombat+=/food,name=seedbattered_fish_plate
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/stealth
actions.precombat+=/potion,name=old_war
actions.precombat+=/marked_for_death,if=raid_event.adds.in>40
actions.precombat+=/roll_the_bones,if=!talent.slice_and_dice.enabled

# Executed every time the actor is available.
# Condition to continue rerolling RtB (2- or not TB alone or not SIW alone during CDs); If SnD: consider that you never have to reroll.
actions=variable,name=rtb_reroll,value=!talent.slice_and_dice.enabled&(rtb_buffs<=1&!rtb_list.any.6&((!buff.curse_of_the_dreadblades.up&!buff.adrenaline_rush.up)|!rtb_list.any.5))
# Condition to use Saber Slash when not rerolling RtB or when using SnD
actions+=/variable,name=ss_useable_noreroll,value=(combo_points<5+talent.deeper_stratagem.enabled-(buff.broadsides.up|buff.jolly_roger.up)-(talent.alacrity.enabled&buff.alacrity.stack<=4))
# Condition to use Saber Slash, when you have RtB or not
actions+=/variable,name=ss_useable,value=(talent.anticipation.enabled&combo_points<4)|(!talent.anticipation.enabled&((variable.rtb_reroll&combo_points<4+talent.deeper_stratagem.enabled)|(!variable.rtb_reroll&variable.ss_useable_noreroll)))
# Normal rotation
actions+=/call_action_list,name=bf
actions+=/call_action_list,name=cds
# Conditions are here to avoid worthless check if nothing is available
actions+=/call_action_list,name=stealth,if=stealthed|cooldown.vanish.up|cooldown.shadowmeld.up
actions+=/death_from_above,if=energy.time_to_max>2&!variable.ss_useable_noreroll
actions+=/slice_and_dice,if=!variable.ss_useable&buff.slice_and_dice.remains<target.time_to_die&buff.slice_and_dice.remains<(1+combo_points)*1.8
actions+=/roll_the_bones,if=!variable.ss_useable&buff.roll_the_bones.remains<target.time_to_die&(buff.roll_the_bones.remains<=3|variable.rtb_reroll)
actions+=/killing_spree,if=energy.time_to_max>5|energy<15
actions+=/call_action_list,name=build
actions+=/call_action_list,name=finish,if=!variable.ss_useable
# Gouge is used as a CP Generator while nothing else is available and you have Dirty Tricks talent. It's unlikely that you'll be able to do this optimally in-game since it requires to move in front of the target, but it's here so you can quantifiy its value.
actions+=/gouge,if=talent.dirty_tricks.enabled&combo_points.deficit>=1

# Blade Flurry
actions.bf=cancel_buff,name=blade_flurry,if=equipped.shivarran_symmetry&cooldown.blade_flurry.up&buff.blade_flurry.up&spell_targets.blade_flurry>=2|spell_targets.blade_flurry<2&buff.blade_flurry.up
actions.bf+=/blade_flurry,if=spell_targets.blade_flurry>=2&!buff.blade_flurry.up

# Builders
actions.build=ghostly_strike,if=combo_points.deficit>=1+buff.broadsides.up&!buff.curse_of_the_dreadblades.up&(debuff.ghostly_strike.remains<debuff.ghostly_strike.duration*0.3|(cooldown.curse_of_the_dreadblades.remains<3&debuff.ghostly_strike.remains<14))&(combo_points>=3|(variable.rtb_reroll&time>=10))
actions.build+=/pistol_shot,if=combo_points.deficit>=1+buff.broadsides.up&buff.opportunity.up&energy.time_to_max>2-talent.quick_draw.enabled
actions.build+=/saber_slash,if=variable.ss_useable

# Cooldowns
actions.cds=potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.adrenaline_rush.up
actions.cds+=/blood_fury
actions.cds+=/berserking
actions.cds+=/arcane_torrent,if=energy.deficit>40
actions.cds+=/cannonball_barrage,if=spell_targets.cannonball_barrage>=1
actions.cds+=/adrenaline_rush,if=!buff.adrenaline_rush.up&energy.deficit>0
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|((raid_event.adds.in>40|buff.true_bearing.remains>15)&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)
actions.cds+=/sprint,if=equipped.thraxis_tricksy_treads&!variable.ss_useable
actions.cds+=/curse_of_the_dreadblades,if=combo_points.deficit>=4&(!talent.ghostly_strike.enabled|debuff.ghostly_strike.up)

# Finishers
actions.finish=between_the_eyes,if=equipped.greenskins_waterlogged_wristcuffs&buff.shark_infested_waters.up
actions.finish+=/run_through,if=!talent.death_from_above.enabled|energy.time_to_max<cooldown.death_from_above.remains+3.5

# Stealth
# Condition to use stealth abilities
actions.stealth=variable,name=stealth_condition,value=(combo_points.deficit>=2+2*(talent.ghostly_strike.enabled&!debuff.ghostly_strike.up)+buff.broadsides.up&energy>60&!buff.jolly_roger.up&!buff.hidden_blade.up&!buff.curse_of_the_dreadblades.up)
actions.stealth+=/ambush
actions.stealth+=/vanish,if=variable.stealth_condition
actions.stealth+=/shadowmeld,if=variable.stealth_condition

head=magicwarped_hood,id=141453,bonus_id=1472
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1727/1808/1497/3336,gems=150vers
shoulders=biornskin_shoulderpads,id=134198,bonus_id=3397/41/1492/1675
back=goldscar_pelt,id=133639,bonus_id=1726/1497/3337
chest=scarred_ragefang_chestpiece,id=139208,bonus_id=1807/1472
shirt=rich_purple_silk_shirt,id=4335
wrists=biornskin_bracer,id=134192,bonus_id=3432/1502/3336
hands=dreamsculptors_gloves,id=139202,bonus_id=1807/1472
waist=forestlords_waistwrap,id=139198,bonus_id=1807/1808/1472
legs=splotched_bloodfur_leggings,id=139201,bonus_id=1807/1472
feet=thraxis_tricksy_treads,id=137031,bonus_id=1811
finger1=dreadful_cyclopean_signet,id=139237,bonus_id=1807/1472
finger2=band_of_fused_coral,id=134532,bonus_id=1727/1497/3336
trinket1=anshes_token_of_guile,id=139113,bonus_id=3432/41/607/1497/1674
trinket2=bloodthirsty_instinct,id=139329,bonus_id=1807/1492/3337
main_hand=the_dreadblades,id=128872,bonus_id=742,gem_id=137302/139261/137270/0,relic_id=3410:1502:3336/1807:1472/3410:1502:3336/0
off_hand=the_dreadblades,id=134552

# Gear Summary
# gear_ilvl=854.56
# gear_agility=13626
# gear_stamina=19786
# gear_crit_rating=4831
# gear_haste_rating=4524
# gear_mastery_rating=6223
# gear_versatility_rating=1546
# gear_leech_rating=786
# gear_armor=2045

Bowflexn

Bowflexn : 475231 dps, 335292 dps to main target

  • Race: Tauren
  • Class: Shaman
  • Spec: Enhancement
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
475231.5 475231.5 562.5 / 0.118% 109729.7 / 23.1% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 3.14% 55.0 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Bowflexn/advanced
Talents
  • 15: Boulderfist (Enhancement Shaman)
  • 30: Wind Rush Totem
  • 45: Lightning Surge Totem
  • 60: Hailstorm (Enhancement Shaman)
  • 75: Tempest (Enhancement Shaman)
  • 90: Crashing Storm (Enhancement Shaman)
  • 100: Landslide (Enhancement Shaman)
  • Talent Calculator
Artifact
Professions
  • leatherworking: 800
  • enchanting: 101
Scale Factors for Bowflexn Damage Per Second
Agi Mastery Haste Vers Crit
Scale Factors 15.25 15.05 12.42 11.59 10.82
Normalized 1.00 0.99 0.81 0.76 0.71
Scale Deltas 1138 1138 1138 1138 1138
Error 0.71 0.71 0.71 0.71 0.71
Gear Ranking
Optimizers
Ranking
  • Agi ~= Mastery > Haste > Vers > Crit
Pawn string ( Pawn: v1: "Bowflexn": Agility=15.25, CritRating=10.82, HasteRating=12.42, MasteryRating=15.05, Versatility=11.59 )

Scale Factors for other metrics

Scale Factors for Bowflexn Damage Per Second
Agi Mastery Haste Vers Crit
Scale Factors 15.25 15.05 12.42 11.59 10.82
Normalized 1.00 0.99 0.81 0.76 0.71
Scale Deltas 1138 1138 1138 1138 1138
Error 0.71 0.71 0.71 0.71 0.71
Gear Ranking
Optimizers
Ranking
  • Agi ~= Mastery > Haste > Vers > Crit
Pawn string ( Pawn: v1: "Bowflexn": Agility=15.25, CritRating=10.82, HasteRating=12.42, MasteryRating=15.05, Versatility=11.59 )
Scale Factors for Bowflexn Priority Target Damage Per Second
Agi Mastery Haste Vers Crit
Scale Factors 10.68 9.50 8.98 8.10 7.67
Normalized 1.00 0.89 0.84 0.76 0.72
Scale Deltas 1138 1138 1138 1138 1138
Error 0.36 0.36 0.36 0.36 0.36
Gear Ranking
Optimizers
Ranking
  • Agi > Mastery > Haste > Vers > Crit
Pawn string ( Pawn: v1: "Bowflexn": Agility=10.68, CritRating=7.67, HasteRating=8.98, MasteryRating=9.50, Versatility=8.10 )
Scale Factors for Bowflexn Damage Per Second (Effective)
Agi Mastery Haste Vers Crit
Scale Factors 15.25 15.05 12.42 11.59 10.82
Normalized 1.00 0.99 0.81 0.76 0.71
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Mastery > Haste > Vers > Crit
Pawn string ( Pawn: v1: "Bowflexn": Agility=15.25, CritRating=10.82, HasteRating=12.42, MasteryRating=15.05, Versatility=11.59 )
Scale Factors for Bowflexn Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Bowflexn Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Bowflexn Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Bowflexn Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Bowflexn Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Bowflexn Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Bowflexn Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for BowflexnTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Bowflexn 475231
Boulderfist 33562 7.1% 76.0 5.29sec 177204 148816 Direct 76.0 135237 276009 177204 29.8% 0.0%  

Stats details: boulderfist

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.03 76.03 0.00 0.00 1.1908 0.0000 13472607.04 13472607.04 0.00 148815.97 148815.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 53.36 70.19% 135236.80 127538 155573 135232.94 132958 139590 7216713 7216713 0.00
crit 22.67 29.81% 276009.08 260178 317370 276009.75 270125 294226 6255894 6255894 0.00
 
 

Action details: boulderfist

Static Values
  • id:201897
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.boulderfist.remains<gcd&maelstrom>=50&active_enemies>=3
Spelldata
  • id:201897
  • name:Boulderfist
  • school:nature
  • tooltip:
  • description:Slams your target with the power of stone, dealing {$s1=1} Nature damage and enhancing your weapons for {$218825d=10 seconds}, increasing your critical strike chance by {$218825s1=5}% and all damage you deal by {$218825s2=5}%. |cFFFFFFFFGenerates {$s2=25} Maelstrom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Crash Lightning 37909 (75502) 7.9% (15.8%) 63.3 6.27sec 472970 399743 Direct 257.1 44579 90946 58454 29.9% 0.0%  

Stats details: crash_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.29 257.10 0.00 0.00 1.1832 0.0000 15028378.62 15028378.62 0.00 399743.44 399743.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.16 70.08% 44578.63 39645 51232 44578.56 43919 46185 8031500 8031500 0.00
crit 76.93 29.92% 90945.77 80876 104514 90945.55 89466 94468 6996879 6996879 0.00
 
 

Action details: crash_lightning

Static Values
  • id:187874
  • school:nature
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:artifact.alpha_wolf.rank&prev_gcd.feral_spirit
Spelldata
  • id:187874
  • name:Crash Lightning
  • school:nature
  • tooltip:Stormstrike and Lava Lash deal an additional $195592sw1 damage to all targets in front of you.
  • description:Electrocutes all enemies in front of you, dealing $sw1 Nature damage. Hitting 2 or more targets enhances your weapons for {$187878d=10 seconds}, causing Stormstrike and Lava Lash to also deal $195592sw1 Nature damage to all targets in front of you.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    Crashing Storm 37593 7.9% 391.9 1.01sec 38038 0 Direct 1647.0 6899 14075 9051 30.0% 0.0%  

Stats details: crashing_storm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 391.88 1646.95 0.00 0.00 0.0000 0.0000 14906408.82 14906408.82 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1153.10 70.01% 6899.23 6014 7922 6899.27 6804 7164 7955493 7955493 0.00
crit 493.85 29.99% 14074.80 12268 16161 14075.00 13876 14538 6950916 6950916 0.00
 
 

Action details: crashing_storm

Static Values
  • id:210801
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210801
  • name:Crashing Storm
  • school:nature
  • tooltip:
  • description:{$@spelldesc192246=Crash Lightning also electrifies the ground, leaving an electrical field behind which damages enemies within it for ${6*{$210801s1=1}} Nature damage over {$210797d=6 seconds}. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.140000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Flametongue 6282 (28254) 1.3% (6.0%) 29.6 13.65sec 381820 323045 Direct 29.6 65015 132629 85218 29.9% 0.0%  

Stats details: flametongue

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.58 29.58 0.00 0.00 1.1820 0.0000 2520434.44 2520434.44 0.00 323045.25 323045.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.74 70.12% 65014.73 64280 74676 65017.39 64280 67746 1348290 1348290 0.00
crit 8.84 29.88% 132628.75 131131 152340 132625.00 131131 145270 1172145 1172145 0.00
 
 

Action details: flametongue

Static Values
  • id:193796
  • school:fire
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.flametongue.remains<gcd
Spelldata
  • id:193796
  • name:Flametongue
  • school:fire
  • tooltip:
  • description:Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.200000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Flametongue Attack 21971 4.6% 1085.2 1.17sec 8084 0 Direct 1085.2 6162 12571 8084 30.0% 0.0%  

Stats details: flametongue_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1085.20 1085.20 0.00 0.00 0.0000 0.0000 8772258.51 8772258.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 759.90 70.02% 6162.50 5369 7073 6162.48 6078 6353 4682902 4682902 0.00
crit 325.30 29.98% 12571.06 10954 14430 12571.17 12404 12939 4089356 4089356 0.00
 
 

Action details: flametongue_attack

Static Values
  • id:10444
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:{$@spelldesc193796=Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Frostbrand 4009 (58645) 0.8% (12.4%) 24.5 16.61sec 958014 803832 Direct 24.5 50100 102197 65757 30.1% 0.0%  

Stats details: frostbrand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.45 24.45 99.78 0.00 1.1918 3.7983 1607805.32 1607805.32 0.00 57391.25 803832.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.10 69.94% 50100.44 49550 57564 50100.70 49550 52850 856803 856803 0.00
crit 7.35 30.06% 102197.24 101081 117430 102175.01 0 117430 751003 751003 0.00
 
 

Action details: frostbrand

Static Values
  • id:196834
  • school:frost
  • resource:maelstrom
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.hailstorm.enabled&buff.frostbrand.remains<gcd
Spelldata
  • id:196834
  • name:Frostbrand
  • school:frost
  • tooltip:Melee attacks reduce target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • description:Chills your target, dealing {$s1=1} Frost damage and reducing the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}, and enhances your weapons with frost for {$d=16 seconds}, causing each weapon attack to reduce the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.925000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.00
  • base_tick_time:5.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Hailstorm 54635 11.5% 1064.7 1.19sec 20490 0 Direct 1064.7 15622 31870 20490 30.0% 0.0%  

Stats details: hailstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1064.72 1064.72 0.00 0.00 0.0000 0.0000 21815859.57 21815859.57 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 745.72 70.04% 15621.65 13876 17931 15621.63 15411 16136 11649376 11649376 0.00
crit 319.00 29.96% 31869.99 28306 36580 31870.11 31455 33088 10166484 10166484 0.00
 
 

Action details: hailstorm

Static Values
  • id:210854
  • school:frost
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210854
  • name:Hailstorm
  • school:frost
  • tooltip:
  • description:{$@spelldesc210853=Frostbrand now also enhances your weapon's damage, causing each of your weapon attacks to also deal $210854sw1 Frost damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.35
 
Lava Lash 5785 (10302) 1.2% (2.2%) 15.8 24.16sec 260563 225943 Direct 15.8 112596 229628 147501 29.8% 0.0%  

Stats details: lava_lash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.81 15.81 0.00 0.00 1.1533 0.0000 2331531.69 2331531.69 0.00 225943.28 225943.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.09 70.18% 112596.47 111352 129362 112575.27 0 124860 1249002 1249002 0.00
crit 4.71 29.82% 229627.70 227159 263898 226443.71 0 263898 1082529 1082529 0.00
 
 

Action details: lava_lash

Static Values
  • id:60103
  • school:fire
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.hot_hand.react
Spelldata
  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing $sw1 Fire damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:5.05
 
    Crash Lightning (lava_lash_cl) 4518 0.9% 7.3 31.78sec 243518 0 Direct 30.6 44565 90918 58398 29.8% 0.0%  

Stats details: lava_lash_cl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.34 30.60 0.00 0.00 0.0000 0.0000 1787188.40 1787188.40 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.47 70.15% 44564.88 44100 51232 44237.76 0 51232 956783 956783 0.00
crit 9.13 29.85% 90918.16 89964 104514 89193.35 0 104514 830405 830405 0.00
 
 

Action details: lava_lash_cl

Static Values
  • id:195592
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:195592
  • name:Crash Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc187874=Electrocutes all enemies in front of you, dealing $sw1 Nature damage. Hitting 2 or more targets enhances your weapons for {$187878d=10 seconds}, causing Stormstrike and Lava Lash to also deal $195592sw1 Nature damage to all targets in front of you. }
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
main_hand 9109 1.9% 163.9 2.46sec 22299 12150 Direct 163.9 19886 40581 22299 29.9% 19.0%  

Stats details: main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 163.90 163.90 0.00 0.00 1.8353 0.0000 3654756.46 5372838.18 31.98 12150.04 12150.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.77 51.11% 19886.04 17882 19914 19885.62 19783 19914 1665760 2448824 31.98
crit 49.01 29.90% 40581.43 36480 40625 40580.76 40289 40625 1988997 2924014 31.98
miss 31.12 18.99% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Mark of the Hidden Satyr 11394 2.4% 24.2 16.45sec 188873 0 Direct 24.2 144099 294170 188870 29.8% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.17 24.17 0.00 0.00 0.0000 0.0000 4564642.47 4564642.47 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.96 70.17% 144099.17 131874 165890 144088.38 140611 153454 2443547 2443547 0.00
crit 7.21 29.83% 294169.80 269023 338416 293897.71 0 338416 2121096 2121096 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
offhand 4541 1.0% 163.3 2.46sec 11155 6062 Direct 163.3 9947 20297 11155 29.9% 19.0%  

Stats details: offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 163.34 163.34 0.00 0.00 1.8400 0.0000 1822058.56 2678598.68 31.98 6062.49 6062.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.41 51.07% 9946.72 8941 9957 9946.54 9893 9957 829692 1219725 31.98
crit 48.89 29.93% 20296.87 18240 20313 20296.68 20153 20313 992367 1458873 31.98
miss 31.03 19.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: offhand

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Potion of the Old War 8584 1.8% 21.2 7.41sec 160280 0 Direct 21.2 122607 250324 160281 29.5% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.17 21.17 0.00 0.00 0.0000 0.0000 3392735.49 4987642.54 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.92 70.50% 122606.71 117137 122994 122602.41 121320 122994 1829756 2689915 31.98
crit 6.24 29.50% 250323.70 238959 250907 250097.33 0 250907 1562979 2297728 31.95
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Stormlash 15238 3.2% 513.5 1.86sec 11893 0 Direct 513.5 11893 0 11893 0.0% 0.0%  

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 513.47 513.47 0.00 0.00 0.0000 0.0000 6106735.77 6106735.77 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 513.47 100.00% 11892.89 1210 76428 11899.84 10412 13606 6106736 6106736 0.00
 
 

Action details: stormlash

Static Values
  • id:213307
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:213307
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:{$@spelldesc195255=While your weapons are enhanced, your attacks have a chance to grant Stormlash to up to {$?s210731=false}[${$m1+$210731m1}][{$s1=2}] party or raid members for {$195222d=8 seconds}, causing attacks and spellcasts to deal additional Nature damage.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:1.800000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6474.77
  • base_dd_max:6474.77
 
Stormstrike 0 (151461) 0.0% (31.8%) 113.6 3.48sec 530568 448647

Stats details: stormstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 113.57 0.00 0.00 0.00 1.1826 0.0000 0.00 0.00 0.00 448647.19 448647.19
 
 

Action details: stormstrike

Static Values
  • id:17364
  • school:physical
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:16.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3&!talent.hailstorm.enabled
Spelldata
  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
    Crash Lightning (stormstrike_cl) 54367 11.3% 82.1 3.57sec 261685 0 Direct 366.6 44656 91100 58579 30.0% 0.0%  

Stats details: stormstrike_cl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.07 366.63 0.00 0.00 0.0000 0.0000 21476685.27 21476685.27 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 256.72 70.02% 44655.88 44100 51232 44655.14 44100 46607 11464269 11464269 0.00
crit 109.91 29.98% 91100.29 89964 104514 91098.93 89964 95650 10012416 10012416 0.00
 
 

Action details: stormstrike_cl

Static Values
  • id:195592
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:195592
  • name:Crash Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc187874=Electrocutes all enemies in front of you, dealing $sw1 Nature damage. Hitting 2 or more targets enhances your weapons for {$187878d=10 seconds}, causing Stormstrike and Lava Lash to also deal $195592sw1 Nature damage to all targets in front of you. }
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    Stormstrike (_mh) 64742 13.6% 142.0 3.48sec 182096 0 Direct 142.0 138723 282968 182096 30.1% 0.0%  

Stats details: stormstrike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 142.01 142.01 0.00 0.00 0.0000 0.0000 25859508.44 38015926.89 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 99.31 69.93% 138722.64 48554 206356 139005.30 119827 159335 13776540 20252818 31.98
crit 42.70 30.07% 282967.84 99051 420966 283574.74 205848 341275 12082969 17763109 31.98
 
 

Action details: stormstrike_mh

Static Values
  • id:32175
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.00
 
    Stormstrike Off-Hand 32352 6.8% 142.0 3.48sec 90987 0 Direct 142.0 69373 141430 90988 30.0% 0.0%  

Stats details: stormstrike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 142.01 142.01 0.00 0.00 0.0000 0.0000 12921161.98 18995332.03 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 99.41 70.00% 69372.68 24277 103178 69511.19 60626 78507 6896532 10138555 31.98
crit 42.60 30.00% 141429.82 49525 210483 141730.40 109158 173126 6024630 8856777 31.98
 
 

Action details: stormstrike_offhand

Static Values
  • id:32176
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.00
 
Unleash Lava 9034 1.9% 70.1 8.50sec 51527 0 Direct 69.7 39475 80521 51798 30.0% 0.0%  

Stats details: unleash_lava

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.08 69.71 0.00 0.00 0.0000 0.0000 3611015.96 3611015.96 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.78 69.98% 39475.27 38958 45259 39474.41 38958 41853 1925723 1925723 0.00
crit 20.93 30.02% 80520.74 79475 92329 80523.56 79475 87092 1685293 1685293 0.00
 
 

Action details: unleash_lava

Static Values
  • id:199053
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:1.2000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:199053
  • name:Unleash Lava
  • school:fire
  • tooltip:
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.800000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Unleash Lightning 9049 1.9% 70.2 8.49sec 51499 0 Direct 69.9 39475 80525 51767 29.9% 0.0%  

Stats details: unleash_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.23 69.87 0.00 0.00 0.0000 0.0000 3616984.83 3616984.83 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.95 70.06% 39475.14 38958 45259 39473.10 38958 42334 1932278 1932278 0.00
crit 20.92 29.94% 80524.89 79475 92329 80522.28 79475 87792 1684706 1684706 0.00
 
 

Action details: unleash_lightning

Static Values
  • id:199054
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:1.2000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:199054
  • name:Unleash Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.800000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Windfury Attack 21367 4.5% 275.5 3.55sec 30931 0 Direct 275.5 23594 48122 30931 29.9% 0.0%  

Stats details: windfury_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 275.53 275.53 0.00 0.00 0.0000 0.0000 8522248.44 12528512.45 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 193.11 70.09% 23593.86 16166 53949 23594.20 19154 28525 4556346 6698259 31.98
crit 82.41 29.91% 48122.21 32979 110057 48118.16 37580 61762 3965903 5830253 31.98
 
 

Action details: windfury_attack

Static Values
  • id:25504
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Each of your main hand attacks has a {$33757h=20}% chance to trigger two extra attacks, dealing $25504sw2 Physical damage each.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.80
 
Windfury Attack (_oh) 2485 0.5% 28.1 27.92sec 35386 0 Direct 28.1 26974 55027 35385 30.0% 0.0%  

Stats details: windfury_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.10 28.10 0.00 0.00 0.0000 0.0000 994412.23 1461880.17 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.67 70.01% 26973.69 24250 26975 26973.70 26346 26975 530704 780185 31.98
crit 8.43 29.99% 55026.89 49469 55028 55004.99 0 55028 463708 681695 31.96
 
 

Action details: windfury_attack_oh

Static Values
  • id:33750
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:33750
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:$@spelldesc8232
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.80
 
pet - frost_wolf 220000 / 11646
Frozen Bite 81838 0.9% 9.5 35.67sec 183375 0 Direct 9.5 140949 281896 183374 30.1% 0.0%  

Stats details: frozen_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.46 9.46 0.00 0.00 0.0000 0.0000 1735531.64 1735531.64 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.62 69.90% 140949.34 128829 161634 140411.46 0 161634 932466 932466 0.00
crit 2.85 30.10% 281895.93 257657 323269 258238.29 0 323269 803066 803066 0.00
 
 

Action details: frozen_bite

Static Values
  • id:224126
  • school:frost
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224126
  • name:Frozen Bite
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Bite the target, causing {$s1=1} Frost damage and slowing the target's movement speed by {$s2=50}% for {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
melee 46615 0.5% 45.0 6.81sec 21930 21575 Direct 45.0 16864 33737 21930 30.0% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.98 44.98 0.00 0.00 1.0165 0.0000 986470.53 1450205.12 31.98 21575.40 21575.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.48 69.98% 16864.38 15635 16885 16862.49 0 16885 530847 780396 31.97
crit 13.51 30.02% 33737.27 31270 33771 33669.34 0 33771 455623 669810 31.91
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Snowstorm 91547 1.0% 15.4 19.43sec 125837 0 Direct 39.7 37586 75179 48868 30.0% 0.0%  

Stats details: snowstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.40 39.66 0.00 0.00 0.0000 0.0000 1938023.56 1938023.56 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.76 69.99% 37586.07 34354 43102 37386.25 0 43102 1043283 1043283 0.00
crit 11.90 30.01% 75179.38 68708 86204 74103.73 0 86204 894741 894741 0.00
 
 

Action details: snowstorm

Static Values
  • id:198483
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198483
  • name:Snowstorm
  • school:frost
  • tooltip:
  • description:Deals {$s1=0} Frost damage to all targets within $A1 yards.
 
pet - fiery_wolf 274377 / 13794
Fiery Jaws 128400 1.4% 9.5 35.62sec 271653 0 Direct 9.5 93901 187859 122182 30.1% 0.0%  
Periodic 37.8 37567 0 37567 0.0% 0.0% 9.4%

Stats details: fiery_jaws

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.51 9.51 37.82 37.82 0.0000 1.0000 2582371.89 2582371.89 0.00 68273.37 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.65 69.91% 93901.32 85886 107757 93545.58 0 107757 624001 624001 0.00
crit 2.86 30.09% 187858.66 171773 215514 173263.07 0 215514 537414 537414 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.8 100.00% 37566.78 34355 43104 37520.37 0 43104 1420956 1420956 0.00
 
 

Action details: fiery_jaws

Static Values
  • id:224125
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224125
  • name:Fiery Jaws
  • school:fire
  • tooltip:Suffering {$s2=1} Fire damage every $t sec.
  • description:Bite the target for {$s1=1} Fire damage, causing an additional $o2 Fire damage over {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.400000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Fire Nova 96360 1.0% 15.5 19.35sec 126046 0 Direct 40.0 37548 75097 48827 30.0% 0.0%  

Stats details: fire_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.50 40.01 0.00 0.00 0.0000 0.0000 1953464.38 1953464.38 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.99 69.96% 37548.46 34354 43102 37354.20 0 43102 1050949 1050949 0.00
crit 12.02 30.04% 75096.66 68708 86204 74084.84 0 86204 902515 902515 0.00
 
 

Action details: fire_nova

Static Values
  • id:198480
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198480
  • name:Fire Nova
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to all targets within $A1 yards.
 
melee 49617 0.5% 45.2 6.77sec 21933 21566 Direct 45.2 16864 33737 21933 30.0% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.15 45.15 0.00 0.00 1.0170 0.0000 990311.01 1455851.00 31.98 21566.48 21566.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.59 69.96% 16864.33 15635 16885 16860.16 0 16885 532731 783166 31.97
crit 13.56 30.04% 33737.29 31270 33771 33698.31 0 33771 457580 672685 31.94
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lightning_wolf 190055 / 8816
melee 76665 0.8% 46.4 6.43sec 30680 30289 Direct 46.4 23604 47231 30681 29.9% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.41 46.41 0.00 0.00 1.0129 0.0000 1423785.98 2093100.25 31.98 30289.45 30289.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.51 70.05% 23604.30 15635 25328 23613.34 21107 25328 767344 1128069 31.98
crit 13.90 29.95% 47230.77 31270 50656 47240.44 0 50656 656442 965031 31.96
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Thunder Bite 113390 1.1% 15.5 19.58sec 135763 0 Direct 35.0 46250 92425 60077 29.9% 0.0%  

Stats details: thunder_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.50 35.04 0.00 0.00 0.0000 0.0000 2104800.79 2104800.79 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.55 70.06% 46249.75 24342 64653 46696.60 0 64653 1135200 1135200 0.00
crit 10.49 29.94% 92424.97 48685 129306 92182.98 0 129306 969601 969601 0.00
 
 

Action details: thunder_bite

Static Values
  • id:198485
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198485
  • name:Thunder Bite
  • school:nature
  • tooltip:
  • description:Deals {$s1=0} Nature damage, jumping to up to $x targets.
 
Simple Action Stats Execute Interval
Bowflexn
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Bowflexn
  • harmful:false
  • if_expr:
 
Doom Winds 6.8 62.49sec

Stats details: doom_winds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.85 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: doom_winds

Static Values
  • id:204945
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:204945
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to proc Windfury weapon on auto attacks increased by 100%. Windfury damage increased by {$s2=200}%.
  • description:Unleashes the inner power of the |cFFFFCC99Doomhammer|r, causing all auto attacks to trigger Windfury, and increasing damage dealt by Windfury by {$s2=200}% for {$d=6 seconds}.
 
Feral Spirit 3.8 120.37sec

Stats details: feral_spirit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.78 0.00 0.00 0.00 1.2230 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: feral_spirit

Static Values
  • id:51533
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects$?a231723[ and grant you {$190185s1=5} Maelstrom each time they attack][].
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Bowflexn
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Bowflexn
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
pet - lightning_wolf
Crackling Surge 9.6 36.41sec

Stats details: crackling_surge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.57 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: crackling_surge

Static Values
  • id:224127
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224127
  • name:Crackling Surge
  • school:nature
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blood Frenzy 14.3 8.6 28.2sec 17.3sec 45.86% 45.86% 8.6(8.6) 13.8

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2743.21

Stack Uptimes

  • blood_frenzy_1:45.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your ranged and melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.12% 11.57% 0.0(0.0) 1.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Boulderfist 2.5 73.6 99.7sec 5.3sec 99.45% 98.17% 73.6(73.6) 1.5

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_boulderfist
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • boulderfist_1:99.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:218825
  • name:Boulderfist
  • tooltip:Critical strike chance increased by {$s1=5}%. Damage dealt increased by {$s2=5}%.
  • description:{$@spelldesc201897=Slams your target with the power of stone, dealing {$s1=1} Nature damage and enhancing your weapons for {$218825d=10 seconds}, increasing your critical strike chance by {$218825s1=5}% and all damage you deal by {$218825s2=5}%. |cFFFFFFFFGenerates {$s2=25} Maelstrom.|r}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Crash Lightning 10.0 28.8 30.0sec 7.5sec 61.04% 69.94% 28.8(28.8) 10.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_crash_lightning
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • crash_lightning_1:61.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187878
  • name:Crash Lightning
  • tooltip:Stormstrike and Lava Lash deal an additional $195592sw1 damage to all targets in front of you.
  • description:{$@spelldesc187874=Electrocutes all enemies in front of you, dealing $sw1 Nature damage. Hitting 2 or more targets enhances your weapons for {$187878d=10 seconds}, causing Stormstrike and Lava Lash to also deal $195592sw1 Nature damage to all targets in front of you. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Dirge of Angerboda 3.8 0.0 79.5sec 79.5sec 7.50% 7.50% 0.0(0.0) 3.7

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_dirge_of_angerboda
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:4534.14

Stack Uptimes

  • dirge_of_angerboda_1:7.50%

Trigger Attempt Success

  • trigger_pct:98.54%

Spelldata details

  • id:214807
  • name:Dirge of Angerboda
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc214798=Your melee attacks have a chance to activate Screams of the Dead, granting you a random combat enhancement for {$214807d=8 seconds}. }
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Doom Winds 6.8 0.0 62.5sec 62.5sec 10.19% 11.85% 0.0(0.0) 6.7

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_doom_winds
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • doom_winds_1:10.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:204945
  • name:Doom Winds
  • tooltip:Chance to proc Windfury weapon on auto attacks increased by 100%. Windfury damage increased by {$s2=200}%.
  • description:Unleashes the inner power of the |cFFFFCC99Doomhammer|r, causing all auto attacks to trigger Windfury, and increasing damage dealt by Windfury by {$s2=200}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:60.00
  • default_chance:0.00%
Flametongue 4.5 25.0 82.1sec 13.6sec 96.07% 96.00% 45.4(45.4) 3.5

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_flametongue
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • flametongue_1:96.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194084
  • name:Flametongue
  • tooltip:Each of your weapon attacks causes up to ${$<coeff>*$AP} additional Fire damage.
  • description:{$@spelldesc193796=Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.}
  • max_stacks:0
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
Frostbrand 7.0 17.5 53.4sec 16.6sec 94.95% 94.43% 53.5(53.5) 6.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_frostbrand
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • frostbrand_1:94.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196834
  • name:Frostbrand
  • tooltip:Melee attacks reduce target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • description:Chills your target, dealing {$s1=1} Frost damage and reducing the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}, and enhances your weapons with frost for {$d=16 seconds}, causing each weapon attack to reduce the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
Gathering Storms 44.8 18.4 8.8sec 6.3sec 45.46% 39.28% 18.4(18.4) 0.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_gathering_storms
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • gathering_storms_1:45.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:198300
  • name:Gathering Storms
  • tooltip:Damage of Stormstrike increased by $w1%.
  • description:{$@spelldesc198299=Each target hit by Crash Lightning increases damage dealt by your next Stormstrike within {$198300d=12 seconds} by {$s1=2}%.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Howl of Ingvar 3.8 0.0 80.0sec 79.9sec 7.49% 7.49% 0.0(0.0) 3.7

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_howl_of_ingvar
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:4534.14

Stack Uptimes

  • howl_of_ingvar_1:7.49%

Trigger Attempt Success

  • trigger_pct:98.55%

Spelldata details

  • id:214802
  • name:Howl of Ingvar
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc214798=Your melee attacks have a chance to activate Screams of the Dead, granting you a random combat enhancement for {$214807d=8 seconds}. }
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Landslide 2.5 73.6 99.7sec 5.3sec 99.45% 97.62% 73.6(73.6) 1.5

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_landslide
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • landslide_1:99.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202004
  • name:Landslide
  • tooltip:Agility increased by {$s1=8}%.
  • description:{$@spelldesc197992={$?s201897=false}[Boulderfist][Rockbiter] now also enhances your weapon, increasing your Agility by {$202004s1=8}% for {$202004d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 121.8sec 0.0sec 12.15% 12.15% 0.0(0.0) 2.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 14.51% 14.51% 2.0(2.0) 0.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.51%

Trigger Attempt Success

  • trigger_pct:100.00%
Stormbringer 41.7 18.3 9.4sec 6.5sec 36.33% 73.68% 25.2(48.4) 0.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_stormbringer
  • max_stacks:2
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormbringer_1:15.08%
  • stormbringer_2:21.25%

Trigger Attempt Success

  • trigger_pct:83.91%

Spelldata details

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike has no cooldown and its cost is reduced by {$s3=50}%.
  • description:{$@spelldesc201845=Each of your main hand attacks has a {$h=5}% chance to reset the remaining cooldown on Stormstrike, and cause your next Stormstrike to cost {$201846s3=50}% less Maelstrom and trigger no cooldown.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Stormlash 18.0 10.8 22.5sec 13.9sec 46.59% 46.59% 10.8(10.8) 17.6

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormlash_1:46.59%

Trigger Attempt Success

  • trigger_pct:99.97%

Spelldata details

  • id:195222
  • name:Stormlash
  • tooltip:Empowered with lightning. Attacks and spellcasts have a chance to deal additional Nature damage.
  • description:{$@spelldesc195255=While your weapons are enhanced, your attacks have a chance to grant Stormlash to up to {$?s210731=false}[${$m1+$210731m1}][{$s1=2}] party or raid members for {$195222d=8 seconds}, causing attacks and spellcasts to deal additional Nature damage.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Unleash Doom 18.0 10.5 21.7sec 13.5sec 33.52% 40.73% 10.5(10.5) 17.7

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_unleash_doom
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00

Stack Uptimes

  • unleash_doom_1:33.52%

Trigger Attempt Success

  • trigger_pct:20.03%

Spelldata details

  • id:199055
  • name:Unleash Doom
  • tooltip:Your special attacks will trugger an arc of fiery or lightning damage at your target.
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Wail of Svala 3.8 0.0 80.5sec 80.5sec 7.46% 7.46% 0.0(0.0) 3.7

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_wail_of_svala
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:4534.14

Stack Uptimes

  • wail_of_svala_1:7.46%

Trigger Attempt Success

  • trigger_pct:98.53%

Spelldata details

  • id:214803
  • name:Wail of Svala
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc214798=Your melee attacks have a chance to activate Screams of the Dead, granting you a random combat enhancement for {$214807d=8 seconds}. }
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Wind Strikes 36.9 34.7 10.6sec 5.4sec 36.57% 54.72% 34.7(34.7) 36.6

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_wind_strikes
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.77

Stack Uptimes

  • wind_strikes_1:36.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:198293
  • name:Wind Strikes
  • tooltip:Attack speed increased by $w1%.
  • description:{$@spelldesc198292=When Stormbringer resets the remaining cooldown on Stormstrike, you gain {$s1=10}% attack speed for {$198293d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
fiery_wolf: Alpha Wolf 1.7 2.0 140.7sec 40.8sec 72.35% 72.35% 9.8(9.8) 0.2

Buff details

  • buff initial source:Bowflexn_fiery_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:72.35%

Trigger Attempt Success

  • trigger_pct:99.02%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
fiery_wolf: Alpha Wolf 1.7 2.0 140.2sec 39.8sec 72.23% 72.23% 9.7(9.7) 0.2

Buff details

  • buff initial source:Bowflexn_fiery_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:72.23%

Trigger Attempt Success

  • trigger_pct:99.14%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
frost_wolf: Alpha Wolf 1.7 2.0 141.7sec 40.9sec 72.19% 72.19% 9.7(9.7) 0.2

Buff details

  • buff initial source:Bowflexn_frost_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:72.19%

Trigger Attempt Success

  • trigger_pct:99.12%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
frost_wolf: Alpha Wolf 1.7 1.9 140.2sec 40.2sec 72.17% 72.17% 9.6(9.6) 0.2

Buff details

  • buff initial source:Bowflexn_frost_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:72.17%

Trigger Attempt Success

  • trigger_pct:98.97%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Alpha Wolf 1.7 1.9 139.3sec 39.9sec 72.27% 72.27% 9.6(9.6) 0.2

Buff details

  • buff initial source:Bowflexn_lightning_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:72.27%

Trigger Attempt Success

  • trigger_pct:98.74%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Alpha Wolf 1.7 2.0 141.9sec 40.3sec 72.48% 72.48% 9.7(9.7) 0.2

Buff details

  • buff initial source:Bowflexn_lightning_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:72.48%

Trigger Attempt Success

  • trigger_pct:99.09%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Crackling Surge 4.7 0.0 30.1sec 30.1sec 76.28% 69.13% 0.0(0.0) 3.1

Buff details

  • buff initial source:Bowflexn_lightning_wolf
  • cooldown name:buff_crackling_surge
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • crackling_surge_1:76.28%

Trigger Attempt Success

  • trigger_pct:99.84%

Spelldata details

  • id:224127
  • name:Crackling Surge
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Crackling Surge 4.8 0.0 30.6sec 30.6sec 76.36% 69.21% 0.0(0.0) 3.2

Buff details

  • buff initial source:Bowflexn_lightning_wolf
  • cooldown name:buff_crackling_surge
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • crackling_surge_1:76.36%

Trigger Attempt Success

  • trigger_pct:99.89%

Spelldata details

  • id:224127
  • name:Crackling Surge
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (nightborne_delicacy_platter)

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Feral Spirit0.5060.0011.2411.0480.0002.917
Crash Lightning1.5980.00171.70695.46633.512188.480
Boulderfist2.1430.0017.40843.36613.14281.052
Stormstrike2.5710.00121.941333.794172.937514.148
Flametongue4.4260.00147.693120.16349.669189.520
Doom Winds2.7920.00140.64414.5360.93749.251

Resources

Resource Usage Type Count Total Average RPE APR
Bowflexn
crash_lightning Maelstrom 63.3 1265.9 20.0 20.0 23648.0
frostbrand Maelstrom 24.5 489.0 20.0 20.0 47900.4
lava_lash Maelstrom 15.8 474.2 30.0 30.0 8685.0
stormstrike Maelstrom 142.0 2867.4 20.2 25.2 21014.3
Resource Gains Type Count Total Average Overflow
Windfury Attack Maelstrom 303.62 1489.09 (28.87%) 4.90 29.02 1.91%
Main Hand Maelstrom 132.78 658.37 (12.77%) 4.96 5.51 0.83%
Off-Hand Maelstrom 132.30 654.52 (12.69%) 4.95 6.99 1.06%
Feral Spirit Maelstrom 106.35 494.30 (9.58%) 4.65 37.44 7.04%
Boulderfist Maelstrom 76.03 1860.98 (36.08%) 24.48 39.74 2.09%
Resource RPS-Gain RPS-Loss
Maelstrom 12.86 12.71
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 60.74 0.00 150.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
Flametongue: Windfury Attack 294.3 3.6sec
Frostbrand: Windfury Attack 288.6 3.6sec
Maelstrom Weapon: Windfury Attack 303.6 3.5sec
Stormbringer: Windfury Attack 24.4 16.8sec
Flametongue: main_hand 125.9 3.2sec
Frostbrand: main_hand 124.0 3.2sec
Maelstrom Weapon: main_hand 132.8 3.0sec
Stormbringer: main_hand 11.8 31.6sec
Windfury: main_hand 42.4 9.4sec
Flametongue: offhand 125.9 3.2sec
Frostbrand: offhand 123.9 3.2sec
Maelstrom Weapon: offhand 132.3 3.0sec
Windfury: offhand 14.1 27.8sec
Flametongue: Crash Lightning 251.0 6.4sec
Frostbrand: Crash Lightning 245.9 6.4sec
Stormbringer: Crash Lightning 22.7 18.3sec
Windfury: Crash Lightning 61.4 10.0sec
Flametongue: Stormstrike 136.2 3.6sec
Frostbrand: Stormstrike 133.3 3.7sec
Stormbringer: Stormstrike 12.6 28.9sec
Windfury: Stormstrike 33.9 12.0sec
Unleash Doom: Stormstrike 70.2 6.8sec
Flametongue: Stormstrike Off-Hand 136.2 3.6sec
Frostbrand: Stormstrike Off-Hand 133.3 3.7sec
Unleash Doom: Stormstrike Off-Hand 70.2 6.8sec
Flametongue: Lava Lash 15.8 24.1sec
Frostbrand: Lava Lash 15.8 24.1sec

Statistics & Data Analysis

Fight Length
Sample Data Bowflexn Fight Length
Count 9999
Mean 401.00
Minimum 308.02
Maximum 501.87
Spread ( max - min ) 193.85
Range [ ( max - min ) / 2 * 100% ] 24.17%
DPS
Sample Data Bowflexn Damage Per Second
Count 9999
Mean 475231.46
Minimum 388132.70
Maximum 581550.65
Spread ( max - min ) 193417.95
Range [ ( max - min ) / 2 * 100% ] 20.35%
Standard Deviation 28695.6794
5th Percentile 430246.38
95th Percentile 523782.31
( 95th Percentile - 5th Percentile ) 93535.94
Mean Distribution
Standard Deviation 286.9711
95.00% Confidence Intervall ( 474669.01 - 475793.92 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 140
0.1% Error 14006
0.1 Scale Factor Error with Delta=300 7029374
0.05 Scale Factor Error with Delta=300 28117498
0.01 Scale Factor Error with Delta=300 702937468
Priority Target DPS
Sample Data Bowflexn Priority Target Damage Per Second
Count 9999
Mean 335291.99
Minimum 286768.29
Maximum 397730.24
Spread ( max - min ) 110961.95
Range [ ( max - min ) / 2 * 100% ] 16.55%
Standard Deviation 14673.3267
5th Percentile 311801.68
95th Percentile 359702.50
( 95th Percentile - 5th Percentile ) 47900.82
Mean Distribution
Standard Deviation 146.7406
95.00% Confidence Intervall ( 335004.38 - 335579.59 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 73
0.1% Error 7357
0.1 Scale Factor Error with Delta=300 1837980
0.05 Scale Factor Error with Delta=300 7351921
0.01 Scale Factor Error with Delta=300 183798027
DPS(e)
Sample Data Bowflexn Damage Per Second (Effective)
Count 9999
Mean 475231.46
Minimum 388132.70
Maximum 581550.65
Spread ( max - min ) 193417.95
Range [ ( max - min ) / 2 * 100% ] 20.35%
Damage
Sample Data Bowflexn Damage
Count 9999
Mean 178785418.32
Minimum 139474430.04
Maximum 226587971.85
Spread ( max - min ) 87113541.81
Range [ ( max - min ) / 2 * 100% ] 24.36%
DTPS
Sample Data Bowflexn Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Bowflexn Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Bowflexn Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Bowflexn Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Bowflexn Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Bowflexn Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data BowflexnTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Bowflexn Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=seventh_demon
1 0.00 augmentation,type=defiled
2 0.00 food,name=nightborne_delicacy_platter
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=old_war
5 0.00 lightning_shield
Default action list Executed every time the actor is available.
# count action,conditions
0.00 wind_shear
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
6 33.00 auto_attack
7 3.78 feral_spirit
8 1.15 crash_lightning,if=artifact.alpha_wolf.rank&prev_gcd.feral_spirit
9 1.00 potion,name=old_war,if=feral_spirit.remains>5|target.time_to_die<=30
0.00 berserking,if=buff.ascendance.up|!talent.ascendance.enabled|level<100
0.00 blood_fury
A 38.42 crash_lightning,if=talent.crashing_storm.enabled&active_enemies>=3
B 5.33 boulderfist,if=buff.boulderfist.remains<gcd&maelstrom>=50&active_enemies>=3
C 32.59 boulderfist,if=buff.boulderfist.remains<gcd|(charges_fractional>1.75&maelstrom<=100&active_enemies<=2)
0.00 crash_lightning,if=buff.crash_lightning.remains<gcd&active_enemies>=2
0.00 windstrike,if=active_enemies>=3&!talent.hailstorm.enabled
0.00 stormstrike,if=active_enemies>=3&!talent.hailstorm.enabled
0.00 windstrike,if=buff.stormbringer.react
D 78.26 stormstrike,if=buff.stormbringer.react
E 11.35 frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<gcd
F 6.57 flametongue,if=buff.flametongue.remains<gcd
0.00 windsong
0.00 ascendance
0.00 fury_of_air,if=!ticking
G 6.85 doom_winds
0.00 crash_lightning,if=active_enemies>=3
0.00 windstrike
H 35.31 stormstrike
0.00 lightning_bolt,if=talent.overcharge.enabled&maelstrom>=60
0.00 lava_lash,if=buff.hot_hand.react
0.00 earthen_spike
I 23.75 crash_lightning,if=active_enemies>1|talent.crashing_storm.enabled|feral_spirit.remains>5
J 13.10 frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<4.8
K 5.09 flametongue,if=buff.flametongue.remains<4.8
0.00 sundering
L 15.81 lava_lash,if=maelstrom>=90
0.00 rockbiter
M 17.93 flametongue
N 38.17 boulderfist

Sample Sequence

0124678CDDCEFGHHDDDN6HILCDDHCJKN6ALNLAN6HMADDHADECADCDIM6CNHIJN6MANDD6ANDMNADDEGNHHI6MNHNJ6NAMN6ADHNADDDEICKN6HN6AJNMAD79DAN6DHADDGHCEIDDF6ADBDADDHADBDAE6DDCFHCILJCNM6ADDDADBDADDHAE6CDDCFGHICJN6A6DHKADBHAHHDMC6DECINHDDMN6ADNJ6NA7DDADHBAFJN6ILGLLIMBN6ADHJ6ADBDADDHKCIJN6NILMN6AHDHNA6DDDAKCDDCEHIC6GMNHHIHHDCDEHCM6INLNIHDDDDCE6DHCFINNLIJ7MN6HILNLILLMCIGHD6CDDDCEHICKLIC

Sample Sequence Table

time name target resources buffs
Pre flask Bowflexn 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre augmentation Bowflexn 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre food Bowflexn 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom potion_of_the_old_war
0:00.000 feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/150: 3% maelstrom potion_of_the_old_war
0:01.209 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom bloodlust, stormlash, potion_of_the_old_war
0:02.190 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom bloodlust, stormbringer(2), wind_strikes, gathering_storms, stormlash, potion_of_the_old_war
0:03.170 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom bloodlust, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, stormlash, potion_of_the_old_war
0:04.149 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom bloodlust, stormbringer, boulderfist, landslide, wind_strikes, stormlash, potion_of_the_old_war
0:05.128 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom bloodlust, boulderfist, landslide, stormlash, potion_of_the_old_war
0:06.108 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 145.0/150: 97% maelstrom bloodlust, boulderfist, landslide, stormlash, potion_of_the_old_war
0:07.065 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, frostbrand, boulderfist, landslide, stormlash, wail_of_svala, potion_of_the_old_war
0:07.940 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, stormlash, wail_of_svala, potion_of_the_old_war
0:07.940 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, doom_winds, stormlash, wail_of_svala, potion_of_the_old_war
0:08.815 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, doom_winds, unleash_doom, wind_strikes, wail_of_svala, potion_of_the_old_war
0:09.691 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, doom_winds, unleash_doom, wind_strikes, wail_of_svala, potion_of_the_old_war
0:10.567 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, doom_winds, unleash_doom, wind_strikes, wail_of_svala, potion_of_the_old_war
0:11.444 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, flametongue, frostbrand, stormbringer, boulderfist, landslide, doom_winds, unleash_doom, wind_strikes, wail_of_svala, potion_of_the_old_war
0:12.322 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, raid_movement, flametongue, frostbrand, boulderfist, landslide, doom_winds, unleash_doom, wind_strikes, wail_of_svala, potion_of_the_old_war
0:13.199 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, doom_winds, unleash_doom, wail_of_svala, potion_of_the_old_war
0:13.199 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, doom_winds, unleash_doom, wail_of_svala, potion_of_the_old_war
0:14.077 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, wail_of_svala, potion_of_the_old_war
0:14.959 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, gathering_storms, potion_of_the_old_war
0:15.939 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, gathering_storms, potion_of_the_old_war
0:16.920 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, potion_of_the_old_war
0:17.899 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom bloodlust, flametongue, frostbrand, stormbringer, boulderfist, landslide, wind_strikes, potion_of_the_old_war
0:18.879 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, wind_strikes, potion_of_the_old_war
0:19.856 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, potion_of_the_old_war
0:20.835 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom bloodlust, raid_movement, flametongue, frostbrand, boulderfist, landslide, potion_of_the_old_war
0:21.814 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom bloodlust, raid_movement, flametongue, frostbrand, boulderfist, landslide, potion_of_the_old_war
0:22.793 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom bloodlust, raid_movement, flametongue, frostbrand, boulderfist, landslide, potion_of_the_old_war
0:23.773 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide
0:23.773 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide
0:24.751 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom bloodlust, flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash
0:25.730 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom bloodlust, flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash
0:26.710 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom bloodlust, flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash
0:27.688 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom bloodlust, flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash
0:28.670 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom bloodlust, raid_movement, flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash
0:29.650 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom bloodlust, flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash
0:29.650 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom bloodlust, flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash
0:30.629 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom bloodlust, flametongue, frostbrand, crash_lightning, boulderfist, landslide, stormlash
0:31.607 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom bloodlust, flametongue, frostbrand, crash_lightning, boulderfist, landslide, stormlash
0:32.584 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash
0:33.561 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom bloodlust, flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, stormlash
0:34.541 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom bloodlust, flametongue, frostbrand, crash_lightning, boulderfist, landslide, wind_strikes, stormlash
0:35.520 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom bloodlust, flametongue, frostbrand, crash_lightning, boulderfist, landslide, stormlash
0:36.498 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash
0:37.476 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom bloodlust, flametongue, frostbrand, crash_lightning, boulderfist, landslide, wind_strikes, stormlash
0:38.456 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom bloodlust, flametongue, frostbrand, crash_lightning, boulderfist, landslide, wind_strikes, stormlash
0:39.434 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom bloodlust, flametongue, frostbrand, crash_lightning, boulderfist, landslide
0:40.415 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms
0:41.429 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, blood_frenzy
0:42.616 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, blood_frenzy
0:43.804 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
0:44.991 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom raid_movement, flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, blood_frenzy
0:46.177 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, blood_frenzy
0:46.177 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, blood_frenzy
0:47.365 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, blood_frenzy
0:48.554 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
0:49.741 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, stormlash, blood_frenzy
0:50.930 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, unleash_doom, gathering_storms, stormlash
0:52.203 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, unleash_doom, gathering_storms, stormlash
0:53.478 Waiting 0.100 sec 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, unleash_doom, gathering_storms, stormlash
0:53.578 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, gathering_storms, stormlash
0:53.578 Waiting 0.900 sec 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, gathering_storms, stormlash
0:54.478 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, gathering_storms, stormlash
0:55.975 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
0:57.164 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, blood_frenzy
0:58.352 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash, blood_frenzy
0:59.539 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, blood_frenzy
1:00.727 Waiting 0.500 sec 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom raid_movement, flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, blood_frenzy
1:01.227 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, blood_frenzy
1:01.227 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, blood_frenzy
1:02.413 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, gathering_storms, stormlash, blood_frenzy
1:03.602 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, gathering_storms, stormlash, blood_frenzy
1:04.790 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, blood_frenzy
1:05.976 Waiting 0.200 sec 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
1:06.176 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
1:07.543 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, blood_frenzy
1:08.731 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, blood_frenzy
1:09.919 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, blood_frenzy
1:11.106 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, crash_lightning, boulderfist, landslide, blood_frenzy
1:12.293 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
1:12.293 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, blood_frenzy
1:13.481 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, blood_frenzy
1:14.669 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, doom_winds, wind_strikes, blood_frenzy
1:15.909 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, unleash_doom, wind_strikes
1:17.180 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, unleash_doom, wind_strikes, gathering_storms
1:17.180 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, unleash_doom, wind_strikes, gathering_storms
1:18.452 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, gathering_storms
1:19.725 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, gathering_storms, stormlash
1:20.998 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/150: 3% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, stormlash
1:22.270 Waiting 0.100 sec 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, stormlash
1:22.370 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, stormlash
1:23.645 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, boulderfist, landslide, stormlash
1:23.645 Waiting 2.200 sec 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, boulderfist, landslide, stormlash
1:25.845 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, boulderfist, landslide, stormlash
1:27.299 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, boulderfist, landslide, stormlash, dirge_of_angerboda
1:28.571 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, dirge_of_angerboda
1:29.843 Waiting 1.100 sec 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, dirge_of_angerboda
1:30.943 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, dirge_of_angerboda
1:32.371 Waiting 0.800 sec 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom raid_movement, flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, dirge_of_angerboda
1:33.171 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, dirge_of_angerboda
1:33.171 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, dirge_of_angerboda
1:34.445 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms
1:35.716 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, wind_strikes, howl_of_ingvar
1:36.989 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, howl_of_ingvar
1:38.262 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, howl_of_ingvar
1:39.534 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, howl_of_ingvar
1:40.807 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, howl_of_ingvar
1:42.077 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, howl_of_ingvar
1:43.350 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, crash_lightning, boulderfist, landslide, wind_strikes
1:44.623 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide
1:45.894 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms
1:47.167 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash
1:48.441 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
1:49.714 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
1:49.714 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
1:50.901 Waiting 0.200 sec 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, stormlash, blood_frenzy
1:51.101 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, stormlash, blood_frenzy
1:52.465 Waiting 1.200 sec 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, stormlash, blood_frenzy
1:53.665 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, boulderfist, landslide, stormlash, blood_frenzy
1:53.665 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, boulderfist, landslide, stormlash, blood_frenzy
1:54.853 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
1:56.040 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash, dirge_of_angerboda, blood_frenzy
1:57.228 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash, dirge_of_angerboda, blood_frenzy
1:58.415 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash, dirge_of_angerboda, blood_frenzy
1:59.603 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash, dirge_of_angerboda, blood_frenzy
2:00.868 feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, stormlash, dirge_of_angerboda
2:02.140 potion Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, stormlash, dirge_of_angerboda
2:02.140 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, stormlash, dirge_of_angerboda, potion_of_the_old_war
2:03.413 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, stormlash, dirge_of_angerboda, potion_of_the_old_war
2:04.686 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom raid_movement, flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, gathering_storms, stormlash, potion_of_the_old_war
2:05.959 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, gathering_storms, stormlash, potion_of_the_old_war
2:05.959 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, gathering_storms, stormlash, potion_of_the_old_war
2:07.230 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, potion_of_the_old_war
2:08.503 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, potion_of_the_old_war
2:09.775 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash, potion_of_the_old_war
2:11.048 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, potion_of_the_old_war
2:12.322 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, stormlash, potion_of_the_old_war
2:12.322 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, stormlash, potion_of_the_old_war
2:13.595 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, stormlash, potion_of_the_old_war
2:14.799 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, blood_frenzy, potion_of_the_old_war
2:15.986 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, blood_frenzy, potion_of_the_old_war
2:17.173 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, doom_winds, wind_strikes, gathering_storms, blood_frenzy, potion_of_the_old_war
2:18.360 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, howl_of_ingvar, blood_frenzy, potion_of_the_old_war
2:19.548 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom frostbrand, boulderfist, landslide, unleash_doom, howl_of_ingvar, blood_frenzy, potion_of_the_old_war
2:20.735 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, howl_of_ingvar, blood_frenzy, potion_of_the_old_war
2:20.735 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, howl_of_ingvar, blood_frenzy, potion_of_the_old_war
2:21.922 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, howl_of_ingvar, blood_frenzy, potion_of_the_old_war
2:23.108 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, howl_of_ingvar, blood_frenzy, potion_of_the_old_war
2:24.296 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, howl_of_ingvar, blood_frenzy, potion_of_the_old_war
2:25.484 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, blood_frenzy, potion_of_the_old_war
2:26.670 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, blood_frenzy, potion_of_the_old_war
2:27.858 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, blood_frenzy
2:29.045 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, blood_frenzy
2:30.313 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom
2:31.586 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms
2:32.856 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash
2:34.129 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom flametongue, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash
2:35.402 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom flametongue, stormbringer, crash_lightning, boulderfist, landslide, stormlash
2:36.677 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom raid_movement, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash
2:37.950 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash
2:37.950 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash
2:39.222 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, stormlash
2:40.494 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom frostbrand, crash_lightning, boulderfist, landslide, unleash_doom
2:41.768 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom frostbrand, crash_lightning, boulderfist, landslide, unleash_doom
2:43.041 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom
2:44.315 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide
2:45.588 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, boulderfist, landslide
2:46.859 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
2:48.133 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
2:49.406 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
2:50.681 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms
2:51.953 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms
2:53.224 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
2:53.224 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
2:54.497 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms
2:55.769 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes
2:57.044 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes
2:58.231 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, blood_frenzy
2:59.417 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, blood_frenzy
3:00.605 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, blood_frenzy
3:01.793 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, blood_frenzy
3:02.981 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
3:04.167 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, blood_frenzy
3:05.352 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, stormlash, blood_frenzy
3:06.539 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, stormlash, blood_frenzy
3:07.774 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, stormlash
3:09.047 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom raid_movement, flametongue, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash
3:10.320 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, gathering_storms, stormlash
3:10.320 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, gathering_storms, stormlash
3:11.592 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, gathering_storms, stormlash
3:12.865 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, stormlash
3:14.138 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom frostbrand, crash_lightning, boulderfist, landslide, unleash_doom
3:15.410 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom frostbrand, crash_lightning, boulderfist, landslide, unleash_doom
3:16.682 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom
3:16.682 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, unleash_doom
3:17.953 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, unleash_doom
3:19.225 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms
3:20.498 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms
3:21.769 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms
3:23.042 Waiting 0.600 sec 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms
3:23.642 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
3:23.642 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
3:24.915 Waiting 0.300 sec 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash
3:25.215 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash
3:25.215 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash
3:26.488 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, wind_strikes, stormlash
3:27.761 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, stormlash
3:29.033 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, stormlash
3:30.304 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash, dirge_of_angerboda
3:31.575 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, wind_strikes, stormlash, dirge_of_angerboda
3:32.848 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, stormlash, dirge_of_angerboda
3:34.120 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, stormlash, dirge_of_angerboda
3:35.304 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash, dirge_of_angerboda, blood_frenzy
3:36.490 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, wind_strikes, stormlash, dirge_of_angerboda, blood_frenzy
3:37.677 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, stormlash, blood_frenzy
3:38.864 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, stormlash, blood_frenzy
3:40.050 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom raid_movement, flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, stormlash, blood_frenzy
3:41.238 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, stormbringer, crash_lightning, boulderfist, landslide, blood_frenzy
3:41.238 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, stormbringer, crash_lightning, boulderfist, landslide, blood_frenzy
3:42.425 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, crash_lightning, boulderfist, landslide, unleash_doom, blood_frenzy
3:43.612 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, blood_frenzy
3:44.848 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom
3:46.121 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, gathering_storms, stormlash
3:47.394 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
3:48.666 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, stormlash
3:49.938 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, unleash_doom, wind_strikes, stormlash
3:51.079 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, unleash_doom, stormlash, wail_of_svala
3:52.216 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, unleash_doom, stormlash, wail_of_svala
3:53.354 Waiting 0.300 sec 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, unleash_doom, stormlash, wail_of_svala
3:53.654 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, boulderfist, landslide, stormlash, wail_of_svala
3:53.654 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, boulderfist, landslide, stormlash, wail_of_svala
3:54.723 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash, wail_of_svala, blood_frenzy
3:55.794 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, stormlash, wail_of_svala, blood_frenzy
3:56.864 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, stormlash, wail_of_svala, blood_frenzy
3:57.935 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wail_of_svala, blood_frenzy
3:57.935 Waiting 1.200 sec 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wail_of_svala, blood_frenzy
3:59.135 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, blood_frenzy
4:00.483 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, blood_frenzy
4:01.670 feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, blood_frenzy
4:02.858 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, blood_frenzy
4:04.044 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, blood_frenzy
4:05.231 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, blood_frenzy
4:06.421 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, blood_frenzy
4:07.496 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, wail_of_svala, blood_frenzy
4:08.566 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, wail_of_svala, blood_frenzy
4:09.637 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, wail_of_svala, blood_frenzy
4:10.754 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, wail_of_svala
4:11.892 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, wail_of_svala
4:13.030 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom raid_movement, flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, wail_of_svala
4:14.167 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, wail_of_svala
4:14.167 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, wail_of_svala
4:15.406 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms
4:16.679 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms
4:16.682 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, gathering_storms
4:17.955 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, gathering_storms
4:19.227 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, gathering_storms
4:20.500 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms
4:21.774 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms
4:23.046 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms
4:24.320 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
4:24.320 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
4:25.592 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash
4:26.867 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, wind_strikes, stormlash
4:28.140 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom raid_movement, flametongue, frostbrand, crash_lightning, boulderfist, landslide, stormlash
4:29.412 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, stormlash
4:29.412 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, stormlash
4:30.686 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash
4:31.958 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, stormlash
4:33.230 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide
4:34.502 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom
4:35.774 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash
4:37.047 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash
4:38.319 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash
4:39.591 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, stormlash
4:40.862 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, stormlash
4:42.134 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, stormlash
4:43.323 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, blood_frenzy
4:44.510 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, blood_frenzy
4:45.698 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, blood_frenzy
4:45.698 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, blood_frenzy
4:47.122 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, blood_frenzy
4:48.308 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
4:49.497 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
4:50.684 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
4:51.871 Waiting 1.700 sec 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
4:53.571 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
4:53.571 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
4:54.843 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash
4:56.114 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash
4:57.386 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash
4:58.659 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash
4:59.931 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash
5:01.204 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash
5:01.204 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash
5:02.476 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash
5:03.750 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes
5:05.023 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, crash_lightning, boulderfist, landslide, unleash_doom
5:06.296 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms
5:07.570 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms
5:08.842 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, stormbringer(2), crash_lightning, boulderfist, landslide, gathering_storms
5:10.113 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, stormbringer, crash_lightning, boulderfist, landslide
5:11.384 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, crash_lightning, boulderfist, landslide, unleash_doom
5:12.656 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, crash_lightning, boulderfist, landslide, unleash_doom
5:13.929 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom
5:15.201 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, stormlash
5:16.473 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
5:17.746 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
5:17.746 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
5:17.746 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash
5:19.017 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash
5:20.290 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, doom_winds, wind_strikes, gathering_storms, stormlash
5:21.563 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, wind_strikes, stormlash
5:22.836 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, wind_strikes
5:24.065 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, blood_frenzy
5:25.137 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, wail_of_svala, blood_frenzy
5:26.207 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, wail_of_svala, blood_frenzy
5:27.277 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, wail_of_svala, blood_frenzy
5:28.347 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, wail_of_svala, dirge_of_angerboda, blood_frenzy
5:29.419 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, boulderfist, landslide, unleash_doom, wail_of_svala, dirge_of_angerboda, blood_frenzy
5:30.490 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, wail_of_svala, dirge_of_angerboda, blood_frenzy
5:31.561 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, wail_of_svala, dirge_of_angerboda, blood_frenzy
5:32.690 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, dirge_of_angerboda, blood_frenzy
5:33.909 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, boulderfist, landslide, dirge_of_angerboda
5:33.909 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, boulderfist, landslide, dirge_of_angerboda
5:35.180 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, dirge_of_angerboda
5:36.453 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
5:37.725 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
5:38.998 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, dirge_of_angerboda
5:40.269 Waiting 0.300 sec 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, dirge_of_angerboda
5:40.569 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, dirge_of_angerboda
5:41.841 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, wind_strikes, dirge_of_angerboda
5:43.114 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, stormlash, dirge_of_angerboda
5:44.387 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, dirge_of_angerboda
5:45.661 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, stormlash, dirge_of_angerboda
5:46.935 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, stormlash
5:48.145 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom raid_movement, flametongue, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, stormlash, blood_frenzy
5:49.332 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, stormlash, blood_frenzy
5:49.332 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, stormlash, blood_frenzy
5:50.520 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, boulderfist, landslide, blood_frenzy
5:51.707 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, boulderfist, landslide, blood_frenzy
5:52.894 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, boulderfist, landslide, blood_frenzy
5:54.080 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, boulderfist, landslide, blood_frenzy
5:55.269 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
5:56.457 Waiting 0.200 sec 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
5:56.657 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
5:58.009 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
5:59.198 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
6:00.461 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
6:01.733 feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
6:03.005 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
6:04.278 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms
6:05.550 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
6:05.550 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
6:06.823 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, boulderfist, landslide
6:08.059 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, wail_of_svala
6:09.198 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, wail_of_svala
6:10.336 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, wail_of_svala
6:11.476 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, wail_of_svala
6:12.615 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, wail_of_svala
6:13.753 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, howl_of_ingvar, wail_of_svala
6:14.891 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, howl_of_ingvar, wail_of_svala
6:16.060 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, howl_of_ingvar
6:17.331 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, howl_of_ingvar
6:18.603 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, howl_of_ingvar
6:18.603 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash, howl_of_ingvar
6:19.875 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, doom_winds, wind_strikes, stormlash, howl_of_ingvar
6:21.148 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, stormbringer, boulderfist, landslide, doom_winds, wind_strikes, stormlash, howl_of_ingvar
6:21.148 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, stormbringer, boulderfist, landslide, doom_winds, wind_strikes, stormlash, howl_of_ingvar
6:22.420 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, stormbringer, boulderfist, landslide, doom_winds, stormlash
6:23.693 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, stormbringer(2), boulderfist, landslide, doom_winds, wind_strikes, stormlash
6:24.965 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, stormbringer, boulderfist, landslide, unleash_doom, wind_strikes, stormlash
6:26.237 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, boulderfist, landslide, unleash_doom
6:27.455 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, boulderfist, landslide, unleash_doom, blood_frenzy
6:28.644 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, blood_frenzy
6:29.831 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, blood_frenzy
6:31.018 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, blood_frenzy
6:32.205 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, blood_frenzy
6:33.393 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
6:34.582 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
6:35.770 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 26457 24751 14545 (11428)
Stamina 34682 34682 20428
Intellect 7651 7326 0
Spirit 0 0 0
Health 2080920 2080920 0
Mana 220000 220000 0
Maelstrom 150 150 0
Spell Power 31748 29701 0
Crit 24.03% 24.03% 3160
Haste 18.25% 18.25% 5932
Damage / Heal Versatility 1.35% 1.35% 542
Attack Power 26457 24751 0
Mastery 60.14% 58.00% 7349
Armor 2575 2575 2575
Run Speed 7 0 1047

Gear

Source Slot Average Item Level: 859.00
Local Head Cave Skulker's Helm
ilevel: 870, stats: { 358 Armor, +2345 Sta, +1563 AgiInt, +1005 Haste, +401 Crit }
Local Neck Wolfstride Pendant
ilevel: 840, stats: { +997 Sta, +1263 Mastery, +505 Haste }, enchant: mark_of_the_hidden_satyr
Local Shoulders Burning Sky Pauldrons
ilevel: 850, stats: { 310 Armor, +973 AgiInt, +1459 Sta, +678 Haste, +301 Mastery }, gems: { +150 Mastery }
Local Shirt Orange Martial Shirt
ilevel: 1
Local Chest Mardum Chain Vest
ilevel: 865, stats: { 434 Armor, +1491 AgiInt, +2237 Sta, +838 Crit, +542 Vers }
Local Waist Manaburst Waistguard
ilevel: 850, stats: { 233 Armor, +973 AgiInt, +1459 Sta, +658 Mastery, +322 Crit, +419 RunSpeed }
Local Legs Mute Erasure Legguards
ilevel: 860, stats: { 373 Armor, +1424 AgiInt, +2136 Sta, +794 Mastery, +561 Haste }, gems: { +200 Agi }
Local Feet Gravenscale Treads of the Feverflare
ilevel: 850, stats: { 284 Armor, +1459 Sta, +973 AgiInt, +699 Haste, +279 Mastery }
Local Wrists Vilescale Bracers
ilevel: 860, stats: { 187 Armor, +801 AgiInt, +1201 Sta, +462 Crit, +299 Haste }
Local Hands Gloves of Wretched Lesions
ilevel: 850, stats: { 259 Armor, +973 AgiInt, +1459 Sta, +699 Haste, +279 Mastery }
Local Finger1 Ring of Twisted Webbing
ilevel: 855, stats: { +1147 Sta, +1176 Mastery, +695 Haste, +320 RunSpeed }, enchant: { +200 Mastery }
Local Finger2 Arch-Druid's Tainted Seal
ilevel: 845, stats: { +1045 Sta, +1287 Mastery, +514 Haste, +308 RunSpeed }, enchant: { +200 Mastery }
Local Trinket1 Memento of Angerboda
ilevel: 865, stats: { +1418 StrAgi }
Local Trinket2 Bloodthirsty Instinct
ilevel: 850, stats: { +1233 Agi }, gems: { +150 Mastery }
Local Back Cloak of Fading Echoes
ilevel: 865, stats: { 137 Armor, +839 StrAgiInt, +1258 Sta, +277 Haste, +499 Crit }, enchant: { +200 Agi }
Local Main Hand Doomhammer
ilevel: 881, weapon: { 4398 - 8169, 2.6 }, stats: { +742 Agi, +1113 Sta, +319 Crit, +306 Mastery }, relics: { +43 ilevels, +43 ilevels, +45 ilevels }
Local Off Hand Fury of the Stonemother
ilevel: 881, weapon: { 4398 - 8169, 2.6 }, stats: { +742 Agi, +1113 Sta, +319 Crit, +306 Mastery }
Local Tabard Nightfallen Tabard
ilevel: 800

Talents

Level
15 Windsong (Enhancement Shaman) Hot Hand (Enhancement Shaman) Boulderfist (Enhancement Shaman)
30 Rainfall (Enhancement Shaman) Feral Lunge (Enhancement Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Lightning Shield (Enhancement Shaman) Ancestral Swiftness Hailstorm (Enhancement Shaman)
75 Tempest (Enhancement Shaman) Overcharge (Enhancement Shaman) Empowered Stormlash (Enhancement Shaman)
90 Crashing Storm (Enhancement Shaman) Fury of Air (Enhancement Shaman) Sundering (Enhancement Shaman)
100 Ascendance (Enhancement Shaman) Landslide (Enhancement Shaman) Earthen Spike (Enhancement Shaman)

Profile

shaman="Bowflexn"
origin="https://us.api.battle.net/wow/character/thrall/Bowflexn/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/69/158226501-avatar.jpg"
level=110
race=tauren
role=attack
position=back
professions=leatherworking=800/enchanting=101
talents=3313112
artifact=41:0:0:0:0:899:1:900:1:901:1:902:1:903:1:904:1:905:2:907:3:908:3:909:3:910:3:911:3:912:3:1351:1
spec=enhancement

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=seventh_demon
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/food,name=nightborne_delicacy_platter
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war
actions.precombat+=/lightning_shield

# Executed every time the actor is available.
actions=wind_shear
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions+=/bloodlust,if=target.health.pct<25|time>0.500
actions+=/auto_attack
actions+=/feral_spirit
actions+=/crash_lightning,if=artifact.alpha_wolf.rank&prev_gcd.feral_spirit
actions+=/potion,name=old_war,if=feral_spirit.remains>5|target.time_to_die<=30
actions+=/berserking,if=buff.ascendance.up|!talent.ascendance.enabled|level<100
actions+=/blood_fury
actions+=/crash_lightning,if=talent.crashing_storm.enabled&active_enemies>=3
actions+=/boulderfist,if=buff.boulderfist.remains<gcd&maelstrom>=50&active_enemies>=3
actions+=/boulderfist,if=buff.boulderfist.remains<gcd|(charges_fractional>1.75&maelstrom<=100&active_enemies<=2)
actions+=/crash_lightning,if=buff.crash_lightning.remains<gcd&active_enemies>=2
actions+=/windstrike,if=active_enemies>=3&!talent.hailstorm.enabled
actions+=/stormstrike,if=active_enemies>=3&!talent.hailstorm.enabled
actions+=/windstrike,if=buff.stormbringer.react
actions+=/stormstrike,if=buff.stormbringer.react
actions+=/frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<gcd
actions+=/flametongue,if=buff.flametongue.remains<gcd
actions+=/windsong
actions+=/ascendance
actions+=/fury_of_air,if=!ticking
actions+=/doom_winds
actions+=/crash_lightning,if=active_enemies>=3
actions+=/windstrike
actions+=/stormstrike
actions+=/lightning_bolt,if=talent.overcharge.enabled&maelstrom>=60
actions+=/lava_lash,if=buff.hot_hand.react
actions+=/earthen_spike
actions+=/crash_lightning,if=active_enemies>1|talent.crashing_storm.enabled|feral_spirit.remains>5
actions+=/frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<4.8
actions+=/flametongue,if=buff.flametongue.remains<4.8
actions+=/sundering
actions+=/lava_lash,if=maelstrom>=90
actions+=/rockbiter
actions+=/flametongue
actions+=/boulderfist

head=cave_skulkers_helm,id=141455,bonus_id=1482/3336
neck=wolfstride_pendant,id=133633,bonus_id=1727/1492/1813,enchant=mark_of_the_hidden_satyr
shoulders=burning_sky_pauldrons,id=137321,bonus_id=3410/1808/1502/3336,gems=150mastery
back=cloak_of_fading_echoes,id=134405,bonus_id=3412/1517/3337,enchant=200agi
chest=mardum_chain_vest,id=134390,bonus_id=3414/1527/3336
shirt=orange_martial_shirt,id=10052
tabard=nightfallen_tabard,id=140575
wrists=vilescale_bracers,id=121316,bonus_id=3412/1522/3336
hands=gloves_of_wretched_lesions,id=137300,bonus_id=1727/1502/3336
waist=manaburst_waistguard,id=134339,bonus_id=3397/42/1512/3337
legs=mute_erasure_legguards,id=134475,bonus_id=3412/1808/1512/3336,gems=200agi
feet=gravenscale_treads,id=128901,bonus_id=689/1697/3408/601/669
finger1=ring_of_twisted_webbing,id=134540,bonus_id=1727/42/1507/3337,enchant=200mastery
finger2=archdruids_tainted_seal,id=134487,bonus_id=1727/42/1497/3336,enchant=200mastery
trinket1=memento_of_angerboda,id=133644,bonus_id=3414/1517/3336
trinket2=bloodthirsty_instinct,id=139329,bonus_id=1807/1808/1472,gems=150mastery
main_hand=doomhammer,id=128819,bonus_id=745,gem_id=136769/141268/137365/0,relic_id=1727:1502:3336/3432:1512:3337/3410:1507:3336/0
off_hand=fury_of_the_stonemother,id=128873

# Gear Summary
# gear_ilvl=858.56
# gear_agility=14545
# gear_stamina=20428
# gear_crit_rating=3160
# gear_haste_rating=5932
# gear_mastery_rating=7349
# gear_versatility_rating=542
# gear_speed_rating=1047
# gear_armor=2575

Alacastria

Alacastria : 442075 dps, 330034 dps to main target

  • Race: Blood Elf
  • Class: Warrior
  • Spec: Arms
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
442075.0 442075.0 474.4 / 0.107% 91623.1 / 20.7% 46604.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
9.4 9.4 Rage 4.71% 73.7 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Alacastria/advanced
Talents
  • 15: Dauntless (Arms Warrior)
  • 30: Double Time
  • 45: Avatar
  • 60: Bounding Stride
  • 75: Focused Rage (Arms Warrior)
  • 90: Deadly Calm (Arms Warrior)
  • 100: Anger Management
  • Talent Calculator
Artifact
Professions
  • mining: 784
  • blacksmithing: 758
Scale Factors for Alacastria Damage Per Second
Str Mastery Haste Vers Crit
Scale Factors 12.16 11.68 11.56 9.83 8.85
Normalized 1.00 0.96 0.95 0.81 0.73
Scale Deltas 1138 1138 1138 1138 1138
Error 0.60 0.60 0.60 0.60 0.59
Gear Ranking
Optimizers
Ranking
  • Str ~= Mastery ~= Haste > Vers > Crit
Pawn string ( Pawn: v1: "Alacastria": Strength=12.16, CritRating=8.85, HasteRating=11.56, MasteryRating=11.68, Versatility=9.83 )

Scale Factors for other metrics

Scale Factors for Alacastria Damage Per Second
Str Mastery Haste Vers Crit
Scale Factors 12.16 11.68 11.56 9.83 8.85
Normalized 1.00 0.96 0.95 0.81 0.73
Scale Deltas 1138 1138 1138 1138 1138
Error 0.60 0.60 0.60 0.60 0.59
Gear Ranking
Optimizers
Ranking
  • Str ~= Mastery ~= Haste > Vers > Crit
Pawn string ( Pawn: v1: "Alacastria": Strength=12.16, CritRating=8.85, HasteRating=11.56, MasteryRating=11.68, Versatility=9.83 )
Scale Factors for Alacastria Priority Target Damage Per Second
Mastery Str Haste Vers Crit
Scale Factors 10.97 8.61 7.63 7.28 6.10
Normalized 1.27 1.00 0.89 0.84 0.71
Scale Deltas 1138 1138 1138 1138 1138
Error 0.41 0.40 0.40 0.40 0.40
Gear Ranking
Optimizers
Ranking
  • Mastery > Str > Haste ~= Vers > Crit
Pawn string ( Pawn: v1: "Alacastria": Strength=8.61, CritRating=6.10, HasteRating=7.63, MasteryRating=10.97, Versatility=7.28 )
Scale Factors for Alacastria Damage Per Second (Effective)
Str Mastery Haste Vers Crit
Scale Factors 12.16 11.68 11.56 9.83 8.85
Normalized 1.00 0.96 0.95 0.81 0.73
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Str > Mastery > Haste > Vers > Crit
Pawn string ( Pawn: v1: "Alacastria": Strength=12.16, CritRating=8.85, HasteRating=11.56, MasteryRating=11.68, Versatility=9.83 )
Scale Factors for Alacastria Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Alacastria": )
Scale Factors for Alacastria Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Alacastria": )
Scale Factors for Alacastria Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Alacastria": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Alacastria": )
Scale Factors for Alacastria Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Alacastria": )
Scale Factors for Alacastria Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Alacastria": )
Scale Factors for Alacastria Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Alacastria": )
Scale Factors for Alacastria Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Alacastria": )
Scale Factors for AlacastriaTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Alacastria": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Alacastria 442075
auto_attack_mh 22170 5.0% 124.6 3.25sec 71310 23426 Direct 124.6 56706 115104 71309 25.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 124.59 124.59 0.00 0.00 3.0440 0.0000 8884811.29 13061514.19 31.98 23426.15 23426.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 93.44 74.99% 56706.27 30592 76476 56698.86 48115 61875 5298467 7789249 31.98
crit 31.16 25.01% 115103.61 61185 152952 115168.64 95397 129794 3586344 5272265 31.98
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Bladestorm 0 (38390) 0.0% (8.6%) 4.4 94.04sec 3415417 665991

Stats details: bladestorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.44 0.00 29.33 0.00 5.1285 0.7392 0.00 0.00 0.00 665991.26 665991.26
 
 

Action details: bladestorm

Static Values
  • id:227847
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:227847
  • name:Bladestorm
  • school:physical
  • tooltip:Dealing damage to all nearby enemies every $t1 sec. Immune to crowd control.
  • description:Become an unstoppable storm of destructive force, striking all targets within $50622A1 yards {$?s23881=false}[with both weapons for ${7*($50622sw2+$95738sw2)} Physical damage][for ${7*$168969sw2} Physical damage] over {$d=6 seconds}. You are immune to movement impairing and loss of control effects, but can use defensive abilities and can avoid attacks.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Bladestorm (_mh) 38390 8.6% 0.0 0.00sec 0 0 Direct 167.2 81416 163317 90782 11.4%  

Stats details: bladestorm_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 167.20 0.00 0.00 0.0000 0.0000 15178606.88 22313989.86 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 148.08 88.56% 81416.21 67856 169628 81421.25 67856 125473 12055650 17722947 31.98
crit 19.12 11.44% 163317.13 135711 339257 163173.53 135711 246227 3122957 4591043 31.98
 
 

Action details: bladestorm_mh

Static Values
  • id:50622
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:50622
  • name:Bladestorm
  • school:physical
  • tooltip:
  • description:You become a whirling storm of destructive force, striking all nearby targets with your main hand weapon for $sw2 Physical damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.35
 
Cleave 16742 (30173) 3.7% (6.8%) 27.2 10.65sec 438411 324776 Direct 163.0 32710 64430 40572 24.8%  

Stats details: cleave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.18 162.99 0.00 0.00 1.3499 0.0000 6612723.39 9721329.76 31.98 324775.79 324775.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 122.59 75.21% 32709.72 25932 64826 32729.48 28117 38304 4009790 5894771 31.98
crit 40.40 24.79% 64430.30 51864 129652 64450.70 52222 91429 2602934 3826559 31.98
 
 

Action details: cleave

Static Values
  • id:845
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:845
  • name:Cleave
  • school:physical
  • tooltip:
  • description:Strikes all enemies in front of you with a sweeping attack for $sw1 Physical damage.$?a231833[ For each target up to {$188923u=5} hit, your next Whirlwind deals {$188923s1=20}% more damage.][]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.90
 
    Void Cleave 13430 3.0% 27.2 10.66sec 195306 0 Direct 163.0 26242 51695 32551 24.8%  

Stats details: void_cleave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.16 162.96 0.00 0.00 0.0000 0.0000 5304599.48 5304599.48 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 122.57 75.22% 26242.47 20806 52013 26258.33 22646 31083 3216655 3216655 0.00
crit 40.39 24.78% 51695.41 41613 104025 51717.42 42306 78218 2087945 2087945 0.00
 
 

Action details: void_cleave

Static Values
  • id:209700
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209700
  • name:Void Cleave
  • school:shadow
  • tooltip:
  • description:{$@spelldesc209573=When Cleave strikes at least {$s1=3} targets, |cFFFFCC99Strom'kar|r releases a burst of void energy, dealing {$209700s1=3} Shadow damage to all nearby enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.750000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3.00
  • base_dd_max:3.00
 
Colossus Smash 38578 8.8% 54.3 7.48sec 285086 211867 Direct 54.3 232589 451031 285086 24.0%  

Stats details: colossus_smash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.30 54.30 0.00 0.00 1.3456 0.0000 15480510.31 22757816.50 31.98 211867.33 211867.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.25 75.97% 232589.49 129957 351608 231890.75 178778 262189 9594713 14105137 31.98
crit 13.05 24.03% 451031.16 259914 703215 450273.33 265261 590577 5885798 8652680 31.98
 
 

Action details: colossus_smash

Static Values
  • id:167105
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.down
Spelldata
  • id:167105
  • name:Colossus Smash
  • school:physical
  • tooltip:
  • description:Smashes the enemy's armor, dealing $sw1 Physical damage, and increasing damage you deal to them by {$208086s3=15}% for {$208086d=8 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.52
 
Corrupted Blood of Zakajz 33242 7.5% 0.0 0.00sec 0 0 Periodic 139.6 95292 0 95292 0.0% 69.6%

Stats details: corrupted_blood_of_zakajz

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 139.57 139.57 0.0000 2.0000 13300028.41 13300028.41 0.00 47645.25 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 139.6 100.00% 95292.19 4674 472611 97528.68 43804 185561 13300028 13300028 0.00
 
 

Action details: corrupted_blood_of_zakajz

Static Values
  • id:209569
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:209569
  • name:Corrupted Blood of Zakajz
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t sec.
  • description:{$@spelldesc209566=For {$209567d=5 seconds} after activating Battle Cry, |cFFFFCC99Strom'kar|r radiates shadowy energy, causing all your attacks to deal an additional {$209567s1=20}% damage as Shadow over {$209569d=6 seconds}.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:50.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Execute 39449 9.1% 30.2 2.38sec 530782 384096 Direct 30.2 371750 811390 530781 36.2%  

Stats details: execute

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.21 30.21 0.00 0.00 1.3819 0.0000 16034087.77 23571627.82 31.98 384096.01 384096.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.28 63.83% 371750.35 46678 606773 374152.48 190912 571767 7168237 10537987 31.98
crit 10.93 36.17% 811389.56 95690 1213546 811641.47 0 1213546 8865851 13033641 31.97
 
 

Action details: execute

Static Values
  • id:163201
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.stone_heart.react
Spelldata
  • id:163201
  • name:Execute
  • school:physical
  • tooltip:
  • description:Attempts to finish off a foe, causing $sw2 Physical damage, and consuming up to $m4 additional Rage to deal up to ${$sw2*$m4/10} additional damage. Only usable on enemies that have less than 20% health.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.62
 
Mortal Strike 121402 27.5% 77.9 5.02sec 623337 466605 Direct 77.9 380726 897454 623333 47.0%  

Stats details: mortal_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.89 77.89 0.00 0.00 1.3359 0.0000 48552144.76 71376251.78 31.98 466605.27 466605.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.32 53.05% 380726.28 108353 669037 380450.94 298543 457318 15731986 23127510 31.98
crit 36.57 46.95% 897453.60 216706 1338075 897749.03 751067 1035106 32820158 48248742 31.98
 
 

Action details: mortal_strike

Static Values
  • id:12294
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:12294
  • name:Mortal Strike
  • school:physical
  • tooltip:
  • description:A vicious strike that deals ${$sw3*$<mult>} Physical damage and reduces the effectiveness of healing on the target for {$115804d=10 seconds}.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.76
 
Potion of the Old War 21109 4.7% 22.0 17.97sec 379495 0 Direct 22.0 283454 590484 379491 31.3%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.02 22.02 0.00 0.00 0.0000 0.0000 8355304.89 12283089.63 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.13 68.72% 283454.43 140279 350676 282887.43 184891 329990 4288687 6304777 31.98
crit 6.89 31.28% 590483.95 280558 701351 590883.94 371124 701351 4066618 5978313 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Slam 21569 5.0% 46.2 7.02sec 189345 142574 Direct 46.2 143622 283656 189342 32.6%  

Stats details: slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.16 46.16 0.00 0.00 1.3281 0.0000 8740189.40 12848906.32 31.98 142573.60 142573.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.09 67.35% 143621.95 74888 187209 144391.44 105135 167561 4465183 6564241 31.98
crit 15.07 32.65% 283655.89 149777 374418 285441.59 178142 374418 4275007 6284665 31.98
 
 

Action details: slam

Static Values
  • id:1464
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:1464
  • name:Slam
  • school:physical
  • tooltip:
  • description:Slams an opponent, causing $sw2 Physical damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.60
 
Warbreaker 12167 2.7% 6.3 66.22sec 762275 571146 Direct 23.8 166444 341659 203264 21.0%  

Stats details: warbreaker

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.34 23.76 0.00 0.00 1.3348 0.0000 4830182.60 4830182.60 0.00 571146.10 571146.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.77 78.99% 166444.09 134777 336921 168814.35 0 313147 3124390 3124390 0.00
crit 4.99 21.01% 341659.03 269554 673843 336670.29 0 673843 1705793 1705793 0.00
 
 

Action details: warbreaker

Static Values
  • id:209577
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.down
Spelldata
  • id:209577
  • name:Warbreaker
  • school:shadow
  • tooltip:
  • description:Stomp the ground, causing a ring of corrupted spikes to erupt upwards, dealing $sw1 Shadow damage and applying the Colossus Smash effect to all nearby enemies.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.50
 
Whirlwind 0 (63826) 0.0% (14.3%) 24.0 11.67sec 1046873 777513

Stats details: whirlwind

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.05 0.00 72.14 0.00 1.3465 0.1333 0.00 0.00 0.00 599426.87 777512.76
 
 

Action details: whirlwind

Static Values
  • id:1680
  • school:physical
  • resource:rage
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.fervor_of_battle.enabled&(debuff.colossus_smash.up|rage.deficit<50)&(!talent.focused_rage.enabled|buff.battle_cry_deadly_calm.up|buff.cleave.up)
Spelldata
  • id:1680
  • name:Whirlwind
  • school:physical
  • tooltip:
  • description:Unleashes a whirlwind of steel, striking all enemies within $199658A1 yards for ${3*$199658sw2} Physical damage.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:0.40
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Whirlwind (_mh) 63826 14.3% 72.1 3.79sec 348958 0 Direct 428.1 46626 88787 58809 28.9%  

Stats details: whirlwind_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.14 428.05 0.00 0.00 0.0000 0.0000 25173530.78 37007474.76 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 304.36 71.10% 46625.56 20213 106110 46824.66 35697 62039 14191280 20862526 31.98
crit 123.69 28.90% 88787.18 40425 212219 89726.82 64173 144628 10982251 16144949 31.98
 
 

Action details: whirlwind_mh

Static Values
  • id:199850
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:199850
  • name:Whirlwind
  • school:physical
  • tooltip:
  • description:{$@spelldesc1680=Unleashes a whirlwind of steel, striking all enemies within $199658A1 yards for ${3*$199658sw2} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.70
 
Simple Action Stats Execute Interval
Alacastria
Arcane Torrent 4.9 91.48sec

Stats details: arcane_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.91 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: arcane_torrent

Static Values
  • id:69179
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.battle_cry_deadly_calm.down&rage.deficit>40
Spelldata
  • id:69179
  • name:Arcane Torrent
  • school:arcane
  • tooltip:Silenced.
  • description:Silence all enemies within $A1 yards for {$d=2 seconds} and increase your Rage by {$/10;s2=15}. Non-player victim spellcasting is also interrupted for {$32747d=3 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:false
  • if_expr:
 
Avatar 5.0 90.00sec

Stats details: avatar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.95 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: avatar

Static Values
  • id:107574
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.bloodlust.up|time>=1)
Spelldata
  • id:107574
  • name:Avatar
  • school:physical
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Transform into a colossus for {$d=20 seconds}, causing you to deal {$s1=20}% increased damage and removing all roots and snares.
 
Battle Cry 13.0 31.98sec

Stats details: battle_cry

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.02 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: battle_cry

Static Values
  • id:1719
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(buff.bloodlust.up|time>=1)&!gcd.remains&(buff.shattered_defenses.up|(cooldown.colossus_smash.remains&cooldown.warbreaker.remains))|target.time_to_die<=10
Spelldata
  • id:1719
  • name:Battle Cry
  • school:physical
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
 
Charge 12.2 30.80sec

Stats details: charge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.23 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: charge

Static Values
  • id:100
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:17.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:100
  • name:Charge
  • school:physical
  • tooltip:
  • description:Charge to an enemy, {$?s103828=false}[stunning][rooting] it for {$?s103828=false}[{$7922d=1.500 seconds}][{$105771d=1.500 seconds}]. |cFFFFFFFFGenerates {$/10;s2=20} Rage.|r
 
Cleansed Drake's Breath 4.1 72.71sec

Stats details: cleansed_drakes_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.11 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cleansed_drakes_breath

Static Values
  • id:222520
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222520
  • name:Cleansed Drake's Breath
  • school:nature
  • tooltip:
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:false
  • if_expr:
 
Focused Rage 166.4 2.36sec

Stats details: focused_rage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 166.41 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: focused_rage

Static Values
  • id:207982
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:15.0
  • secondary_cost:0.0
  • cooldown:1.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.battle_cry_deadly_calm.remains>cooldown.focused_rage.remains&(buff.focused_rage.stack<3|!cooldown.mortal_strike.up)&((!buff.focused_rage.react&prev_gcd.mortal_strike)|!prev_gcd.mortal_strike)
Spelldata
  • id:207982
  • name:Focused Rage
  • school:physical
  • tooltip:Next Mortal Strike deals {$s1=30}% increased damage.
  • description:Focus your rage on your next Mortal Strike, increasing its damage by {$s1=30}%, stacking up to {$u=3} times. Unaffected by the global cooldown
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:false
  • if_expr:
 
Heroic Leap 13.1 31.71sec

Stats details: heroic_leap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.11 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: heroic_leap

Static Values
  • id:6544
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.up
Spelldata
  • id:6544
  • name:Heroic Leap
  • school:physical
  • tooltip:
  • description:Leap through the air toward a target location, slamming down with destructive force to deal {$52174s1=1} Physical damage to all enemies within $52174a1 yards{$?s23922=false}[, and resetting the remaining cooldown on Taunt][].
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Acceleration 6.4 1.1 57.9sec 48.1sec 17.18% 17.18% 1.1(1.1) 6.2

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_acceleration
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:5114.20

Stack Uptimes

  • acceleration_1:17.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:214128
  • name:Acceleration
  • tooltip:Haste increased by $w1. Movement speed increased by $w2%.
  • description:{$@spelldesc214120=Your spells and abilities have a chance to grant you {$214128s1=4657} Haste and {$214128s2=15}% movement speed for {$214128d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Avatar 5.0 0.0 90.0sec 90.0sec 24.08% 24.08% 0.0(0.0) 4.7

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_avatar
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • avatar_1:24.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:107574
  • name:Avatar
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Transform into a colossus for {$d=20 seconds}, causing you to deal {$s1=20}% increased damage and removing all roots and snares.
  • max_stacks:0
  • duration:20.00
  • cooldown:90.00
  • default_chance:0.00%
Battle Cry 13.0 0.0 32.0sec 32.0sec 16.13% 16.13% 0.0(0.0) 12.9

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_battle_cry
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • battle_cry_1:16.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1719
  • name:Battle Cry
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:0.00%
Bladestorm 4.4 0.0 94.0sec 94.0sec 5.46% 5.46% 0.0(0.0) 0.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_bladestorm
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bladestorm_1:5.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:227847
  • name:Bladestorm
  • tooltip:Dealing damage to all nearby enemies every $t1 sec. Immune to crowd control.
  • description:Become an unstoppable storm of destructive force, striking all targets within $50622A1 yards {$?s23881=false}[with both weapons for ${7*($50622sw2+$95738sw2)} Physical damage][for ${7*$168969sw2} Physical damage] over {$d=6 seconds}. You are immune to movement impairing and loss of control effects, but can use defensive abilities and can avoid attacks.
  • max_stacks:0
  • duration:6.00
  • cooldown:90.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.12% 10.81% 0.0(0.0) 1.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
charge_movement 11.2 0.0 30.7sec 30.7sec 1.23% 11.16% 0.0(0.0) 0.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_charge_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • charge_movement_1:1.23%

Trigger Attempt Success

  • trigger_pct:100.00%
Cleansed Ancient's Blessing 3.7 0.0 81.0sec 81.0sec 9.18% 9.18% 0.0(0.0) 3.6

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_cleansed_ancients_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2572.28

Stack Uptimes

  • cleansed_ancients_blessing_1:9.18%

Trigger Attempt Success

  • trigger_pct:98.33%

Spelldata details

  • id:222517
  • name:Cleansed Ancient's Blessing
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Sister's Blessing 3.7 0.0 81.7sec 81.7sec 9.08% 9.08% 0.0(0.0) 3.6

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_cleansed_sisters_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2572.28

Stack Uptimes

  • cleansed_sisters_blessing_1:9.08%

Trigger Attempt Success

  • trigger_pct:98.22%

Spelldata details

  • id:222519
  • name:Cleansed Sister's Blessing
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleansed Wisp's Blessing 3.7 0.0 81.8sec 81.8sec 9.08% 9.08% 0.0(0.0) 3.6

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_cleansed_wisps_blessing
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2572.28

Stack Uptimes

  • cleansed_wisps_blessing_1:9.08%

Trigger Attempt Success

  • trigger_pct:98.18%

Spelldata details

  • id:222518
  • name:Cleansed Wisp's Blessing
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc222512=Your melee attacks have a chance to grant you a blessing of one of the Allies of Nature for {$222519d=10 seconds}. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Cleave 25.5 1.7 11.4sec 10.6sec 24.79% 24.79% 0.0(0.0) 7.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_cleave
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.22

Stack Uptimes

  • cleave_1:23.18%
  • cleave_2:1.52%
  • cleave_3:0.10%
  • cleave_4:0.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188923
  • name:Cleave
  • tooltip:Increases the damage done by your next Whirlwind by $w1%.
  • description:{$@spelldesc845=Strikes all enemies in front of you with a sweeping attack for $sw1 Physical damage.$?a231833[ For each target up to {$188923u=5} hit, your next Whirlwind deals {$188923s1=20}% more damage.][]}
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Corrupted Blood of Zakajz 13.0 0.0 32.0sec 32.0sec 16.13% 18.11% 0.0(0.0) 12.9

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_corrupted_blood_of_zakajz
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • corrupted_blood_of_zakajz_1:16.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:209567
  • name:Corrupted Blood of Zakajz
  • tooltip:An additional {$s1=20}% of all damage dealt will be done to your enemies over {$209569d=6 seconds}.
  • description:{$@spelldesc209566=For {$209567d=5 seconds} after activating Battle Cry, |cFFFFCC99Strom'kar|r radiates shadowy energy, causing all your attacks to deal an additional {$209567s1=20}% damage as Shadow over {$209569d=6 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:101.00%
Focused Rage 69.7 96.7 5.6sec 2.4sec 69.15% 88.19% 3.4(3.4) 0.1

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_focused_rage
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • focused_rage_1:34.57%
  • focused_rage_2:21.21%
  • focused_rage_3:13.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207982
  • name:Focused Rage
  • tooltip:Next Mortal Strike deals {$s1=30}% increased damage.
  • description:Focus your rage on your next Mortal Strike, increasing its damage by {$s1=30}%, stacking up to {$u=3} times. Unaffected by the global cooldown
  • max_stacks:3
  • duration:30.00
  • cooldown:1.50
  • default_chance:100.00%
heroic_leap_movement 1.0 0.0 119.2sec 119.2sec 0.12% 0.71% 0.0(0.0) 0.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_heroic_leap_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • heroic_leap_movement_1:0.12%

Trigger Attempt Success

  • trigger_pct:68.26%
Mark of the Heavy Hide 9.0 2.4 42.9sec 33.2sec 25.15% 25.15% 2.4(2.4) 8.8

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_mark_of_the_heavy_hide
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:bonus_armor
  • amount:3000.00

Stack Uptimes

  • mark_of_the_heavy_hide_1:25.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:228399
  • name:Mark of the Heavy Hide
  • tooltip:Armor increased by {$s1=3000}.
  • description:Armor increased by {$s1=3000}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 338.6sec 0.0sec 12.15% 12.15% 0.0(0.0) 2.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Precise Strikes 60.6 0.1 6.7sec 6.7sec 34.64% 34.64% 0.1(0.1) 0.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_precise_strikes
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.45

Stack Uptimes

  • precise_strikes_1:34.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:209493
  • name:Precise Strikes
  • tooltip:
  • description:{$@spelldesc209492=Colossus Smash reduces the Rage cost of your next Mortal Strike or Execute by {$s1=15}%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
raid_movement 33.8 1.0 11.6sec 11.3sec 8.73% 8.73% 1.0(1.0) 0.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:8.73%

Trigger Attempt Success

  • trigger_pct:100.00%
Shattered Defenses 60.6 0.0 6.7sec 6.7sec 34.64% 55.90% 0.0(0.0) 0.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_shattered_defenses
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • shattered_defenses_1:34.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:209706
  • name:Shattered Defenses
  • tooltip:Damage and critical strike chance of your next Mortal Strike or Execute increased by {$s1=30}%.
  • description:{$@spelldesc209574=After using Colossus Smash, your next Mortal Strike or Execute gains {$209706s1=30}% increased critical strike chance and deals {$209706s2=30}% additional damage.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (nightborne_delicacy_platter)

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Charge16.5400.001169.038144.16535.228323.072
Battle Cry1.7330.00112.1509.5770.00027.274
Avatar0.0900.0011.4040.0020.0001.404
Heroic Leap2.0150.00128.23020.8232.77879.386
Focused Rage2.1280.00140.694169.401101.012249.601
Colossus Smash1.7000.00113.32889.44543.155155.783
Warbreaker6.9950.001105.25533.1580.220130.141
Mortal Strike1.3630.00135.138100.03753.320175.996
Bladestorm4.4090.001129.71913.8810.000142.591
Cleave5.7140.00154.090137.43490.621182.599

Resources

Resource Usage Type Count Total Average RPE APR
Alacastria
cleave Rage 27.2 183.0 6.7 6.7 65138.1
execute Rage 30.2 611.7 20.2 20.2 26211.9
focused_rage Rage 166.4 1385.5 8.3 8.3 0.0
mortal_strike Rage 77.9 669.2 8.6 8.6 72556.8
slam Rage 46.2 556.4 12.1 12.1 15707.3
whirlwind Rage 24.0 380.3 15.8 15.8 66186.6
Resource Gains Type Count Total Average Overflow
charge Rage 12.23 237.92 (6.22%) 19.46 6.66 2.72%
arcane_torrent Rage 4.91 73.59 (1.92%) 15.00 0.00 0.00%
melee_crit Rage 31.16 1074.61 (28.10%) 34.49 75.15 6.54%
melee_main_hand Rage 93.44 2299.12 (60.13%) 24.61 55.51 2.36%
will_of_the_first_king Rage 142.72 138.37 (3.62%) 0.97 4.35 3.05%
Resource RPS-Gain RPS-Loss
Rage 9.54 9.44
Combat End Resource Mean Min Max
Rage 37.14 0.00 130.00

Benefits & Uptimes

Benefits %
Uptimes %
Rage Cap 3.4%

Procs

Count Interval
delayed_auto_attack 5.4 57.0sec
tactician 61.0 6.6sec

Statistics & Data Analysis

Fight Length
Sample Data Alacastria Fight Length
Count 9999
Mean 401.00
Minimum 308.02
Maximum 501.87
Spread ( max - min ) 193.85
Range [ ( max - min ) / 2 * 100% ] 24.17%
DPS
Sample Data Alacastria Damage Per Second
Count 9999
Mean 442075.04
Minimum 356689.91
Maximum 527673.50
Spread ( max - min ) 170983.59
Range [ ( max - min ) / 2 * 100% ] 19.34%
Standard Deviation 24203.5812
5th Percentile 402890.13
95th Percentile 481810.43
( 95th Percentile - 5th Percentile ) 78920.30
Mean Distribution
Standard Deviation 242.0479
95.00% Confidence Intervall ( 441600.64 - 442549.45 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 115
0.1% Error 11514
0.1 Scale Factor Error with Delta=300 5000839
0.05 Scale Factor Error with Delta=300 20003358
0.01 Scale Factor Error with Delta=300 500083965
Priority Target DPS
Sample Data Alacastria Priority Target Damage Per Second
Count 9999
Mean 330034.23
Minimum 270366.90
Maximum 389901.26
Spread ( max - min ) 119534.36
Range [ ( max - min ) / 2 * 100% ] 18.11%
Standard Deviation 16169.0560
5th Percentile 302774.87
95th Percentile 356300.68
( 95th Percentile - 5th Percentile ) 53525.81
Mean Distribution
Standard Deviation 161.6986
95.00% Confidence Intervall ( 329717.30 - 330351.15 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 92
0.1% Error 9220
0.1 Scale Factor Error with Delta=300 2231788
0.05 Scale Factor Error with Delta=300 8927153
0.01 Scale Factor Error with Delta=300 223178830
DPS(e)
Sample Data Alacastria Damage Per Second (Effective)
Count 9999
Mean 442075.04
Minimum 356689.91
Maximum 527673.50
Spread ( max - min ) 170983.59
Range [ ( max - min ) / 2 * 100% ] 19.34%
Damage
Sample Data Alacastria Damage
Count 9999
Mean 176446719.97
Minimum 134735297.60
Maximum 223013199.83
Spread ( max - min ) 88277902.23
Range [ ( max - min ) / 2 * 100% ] 25.02%
DTPS
Sample Data Alacastria Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Alacastria Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Alacastria Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Alacastria Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Alacastria Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Alacastria Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data AlacastriaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Alacastria Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=countless_armies
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
5 12.23 charge
6 6.38 auto_attack
7 1.00 potion,name=old_war,if=(target.health.pct<20&buff.battle_cry.up)|target.time_to_die<=26
0.00 blood_fury,if=buff.battle_cry.up|target.time_to_die<=16
0.00 berserking,if=buff.battle_cry.up|target.time_to_die<=11
8 4.91 arcane_torrent,if=buff.battle_cry_deadly_calm.down&rage.deficit>40
9 13.02 battle_cry,if=(buff.bloodlust.up|time>=1)&!gcd.remains&(buff.shattered_defenses.up|(cooldown.colossus_smash.remains&cooldown.warbreaker.remains))|target.time_to_die<=10
A 4.95 avatar,if=(buff.bloodlust.up|time>=1)
B 13.11 heroic_leap,if=debuff.colossus_smash.up
0.00 rend,if=remains<gcd
C 50.95 focused_rage,if=buff.battle_cry_deadly_calm.remains>cooldown.focused_rage.remains&(buff.focused_rage.stack<3|!cooldown.mortal_strike.up)&((!buff.focused_rage.react&prev_gcd.mortal_strike)|!prev_gcd.mortal_strike)
The tl;dr of this line is to spam focused rage inside battle cry, the added nonsense is to help modeling the difficulty of timing focused rage immediately after mortal strike. # In game, if focused rage is used the same instant as mortal strike, rage will be deducted for focused rage, the buff is immediately consumed, but it does not buff the damage of mortal strike.
D 15.98 colossus_smash,if=debuff.colossus_smash.down
E 1.66 warbreaker,if=debuff.colossus_smash.down
0.00 ravager
0.00 overpower,if=buff.overpower.react
F 0.00 run_action_list,name=cleave,if=spell_targets.whirlwind>=2&talent.sweeping_strikes.enabled
G 0.00 run_action_list,name=aoe,if=spell_targets.whirlwind>=2&!talent.sweeping_strikes.enabled
H 0.00 run_action_list,name=execute,if=target.health.pct<=20
I 0.00 run_action_list,name=single,if=target.health.pct>20
actions.aoe
# count action,conditions
J 44.55 mortal_strike
0.00 execute,if=buff.stone_heart.react
K 13.11 colossus_smash,if=buff.shattered_defenses.down&buff.precise_strikes.down
L 2.55 warbreaker,if=buff.shattered_defenses.down
0.00 whirlwind,if=talent.fervor_of_battle.enabled&(debuff.colossus_smash.up|rage.deficit<50)&(!talent.focused_rage.enabled|buff.battle_cry_deadly_calm.up|buff.cleave.up)
0.00 rend,if=remains<=duration*0.3
M 3.95 bladestorm
N 27.18 cleave
O 24.05 whirlwind,if=rage>=60
0.00 shockwave
0.00 storm_bolt
actions.execute
# count action,conditions
P 2.52 mortal_strike,if=buff.battle_cry.up&buff.focused_rage.stack=3
Q 5.35 execute,if=buff.battle_cry_deadly_calm.up
R 7.81 colossus_smash,if=buff.shattered_defenses.down
S 0.68 warbreaker,if=buff.shattered_defenses.down&rage<=30
T 24.86 execute,if=buff.shattered_defenses.up&rage>22|buff.shattered_defenses.down
U 0.45 bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets
actions.single+=/heroic_charge,if=rage.deficit>=40&(!cooldown.heroic_leap.remains|swing.mh.remains>1.2) #Remove the # above to run out of melee and charge back in for rage.
actions.single
# count action,conditions
V 2.69 mortal_strike,if=buff.battle_cry.up&buff.focused_rage.stack>=1&buff.battle_cry.remains<gcd
W 17.39 colossus_smash,if=buff.shattered_defenses.down
X 1.45 warbreaker,if=buff.shattered_defenses.down&cooldown.mortal_strike.remains<gcd
Y 115.46 focused_rage,if=(((!buff.focused_rage.react&prev_gcd.mortal_strike)|!prev_gcd.mortal_strike)&buff.focused_rage.stack<3&(buff.shattered_defenses.up|cooldown.colossus_smash.remains))&rage>60
Z 28.13 mortal_strike
0.00 execute,if=buff.stone_heart.react
a 46.16 slam
0.00 execute,if=equipped.archavons_heavy_hand
0.00 focused_rage,if=equipped.archavons_heavy_hand
b 0.04 bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets
actions.single+=/heroic_charge,if=rage.deficit>=40&(!cooldown.heroic_leap.remains|swing.mh.remains>1.2) #Remove the # above to run out of melee and charge back in for rage.

Sample Sequence

0124568DYAY9BZCWCZCaCaYXZYaYYaaZYaaaZaaa56JMJYYDJJKY9BNCOCJCOCNCOJDYYaYaZWYYZYaYaa56JNOJYN5ODYY9BJCKCNCOJYaYYaEZYaYaWY5JYNYYOJNY8OADYBJY9NCOCOCJYaDYYZWYYZWYYZ5NYYMJYYNYDJYJ5KYYBNY9OJCKCCaaZYaYYaDZYLYYJKYYNYJKYNYJOYNDY9BCJCaCWCVWYYaYZWY5NYYOJYOYJDN8JAKYYNYJOJDY9BaCaCZCVCWYZWY56NYYMEJYNYYOOJDYYNYJWYYBaY9aCZCaCVDY5NYYOJYOJDYYNYOJKYYJKYNaBYZa9CaCaCZCa5NDYYJYOYNLYJA8JJKYYJJKYYNYaBZYWZY9aCWCZC5KCYNJKYYMJYNYDYJJKYYNYaZYBaWYZYaW9CZCaCWCVTRTTTTTETTTBT5TDTR97CQCQCPCQRATTRTT8RTRTBTTRTTTT9CQCDPCQCTRTTU

Sample Sequence Table

time name target resources buffs
Pre flask Alacastria 0.0/130: 0% rage
Pre food Alacastria 0.0/130: 0% rage
Pre augmentation Alacastria 0.0/130: 0% rage
Pre potion Fluffy_Pillow 0.0/130: 0% rage potion_of_the_old_war
0:00.000 charge Fluffy_Pillow 0.0/130: 0% rage potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 20.0/130: 15% rage mark_of_the_heavy_hide, potion_of_the_old_war
0:00.000 arcane_torrent Fluffy_Pillow 45.2/130: 35% rage mark_of_the_heavy_hide, potion_of_the_old_war
0:00.000 colossus_smash Fluffy_Pillow 60.2/130: 46% rage mark_of_the_heavy_hide, potion_of_the_old_war
0:00.000 focused_rage Fluffy_Pillow 48.2/130: 37% rage focused_rage, precise_strikes, shattered_defenses, mark_of_the_heavy_hide, potion_of_the_old_war
0:01.000 avatar Fluffy_Pillow 73.4/130: 56% rage bloodlust, avatar, focused_rage, precise_strikes, shattered_defenses, cleansed_sisters_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
0:01.251 focused_rage Fluffy_Pillow 61.4/130: 47% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, cleansed_sisters_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
0:01.254 battle_cry Fluffy_Pillow 61.4/130: 47% rage bloodlust, avatar, focused_rage(2), precise_strikes, shattered_defenses, cleansed_sisters_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
0:01.254 heroic_leap Fluffy_Pillow 61.4/130: 47% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, cleansed_sisters_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
0:01.254 mortal_strike Fluffy_Pillow 61.4/130: 47% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, cleansed_sisters_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
0:02.270 focused_rage Fluffy_Pillow 61.4/130: 47% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, cleansed_sisters_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
0:02.275 colossus_smash Fluffy_Pillow 61.4/130: 47% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, cleansed_sisters_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
0:03.289 focused_rage Fluffy_Pillow 98.4/130: 76% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, cleansed_sisters_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
0:03.298 mortal_strike Fluffy_Pillow 98.4/130: 76% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, cleansed_sisters_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
0:04.308 focused_rage Fluffy_Pillow 98.4/130: 76% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, cleansed_sisters_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
0:04.322 slam Fluffy_Pillow 98.4/130: 76% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, cleansed_sisters_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
0:05.327 focused_rage Fluffy_Pillow 130.0/130: 100% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry, cleansed_sisters_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
0:05.347 slam Fluffy_Pillow 130.0/130: 100% rage bloodlust, avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry, cleansed_sisters_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
0:06.346 focused_rage Fluffy_Pillow 118.0/130: 91% rage bloodlust, avatar, focused_rage(3), cleansed_sisters_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
0:06.370 warbreaker Fluffy_Pillow 118.0/130: 91% rage bloodlust, avatar, focused_rage(3), cleansed_sisters_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
0:07.394 mortal_strike Fluffy_Pillow 118.0/130: 91% rage bloodlust, avatar, focused_rage(3), precise_strikes, shattered_defenses, cleansed_sisters_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
0:07.394 focused_rage Fluffy_Pillow 97.2/130: 75% rage bloodlust, avatar, focused_rage, cleansed_sisters_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
0:08.417 slam Fluffy_Pillow 122.4/130: 94% rage bloodlust, avatar, focused_rage, cleansed_sisters_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
0:08.417 focused_rage Fluffy_Pillow 94.4/130: 73% rage bloodlust, avatar, focused_rage(2), cleansed_sisters_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
0:09.436 focused_rage Fluffy_Pillow 82.4/130: 63% rage bloodlust, avatar, focused_rage(3), cleansed_sisters_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
0:09.441 slam Fluffy_Pillow 82.4/130: 63% rage bloodlust, avatar, focused_rage(3), cleansed_sisters_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
0:10.497 slam Fluffy_Pillow 91.6/130: 70% rage bloodlust, avatar, focused_rage(3), cleansed_wisps_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
0:11.598 mortal_strike Fluffy_Pillow 75.6/130: 58% rage bloodlust, avatar, focused_rage(3), cleansed_wisps_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
0:12.700 focused_rage Fluffy_Pillow 84.8/130: 65% rage bloodlust, raid_movement, avatar, cleansed_wisps_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
0:12.700 slam Fluffy_Pillow 72.8/130: 56% rage bloodlust, raid_movement, avatar, focused_rage, cleansed_wisps_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
0:13.804 slam Fluffy_Pillow 56.8/130: 44% rage bloodlust, avatar, focused_rage, cleansed_wisps_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
0:14.904 slam Fluffy_Pillow 40.8/130: 31% rage bloodlust, avatar, focused_rage, cleansed_wisps_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
0:16.005 mortal_strike Fluffy_Pillow 50.0/130: 38% rage bloodlust, avatar, focused_rage, cleansed_wisps_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
0:17.106 slam Fluffy_Pillow 34.0/130: 26% rage bloodlust, avatar, cleansed_wisps_blessing, mark_of_the_heavy_hide, potion_of_the_old_war
0:18.205 slam Fluffy_Pillow 43.2/130: 33% rage bloodlust, avatar, cleansed_wisps_blessing, potion_of_the_old_war
0:19.306 slam Fluffy_Pillow 27.2/130: 21% rage bloodlust, avatar, cleansed_wisps_blessing, potion_of_the_old_war
0:20.406 charge Fluffy_Pillow 11.2/130: 9% rage bloodlust, raid_movement, avatar, potion_of_the_old_war
0:20.406 Waiting 0.500 sec 31.2/130: 24% rage bloodlust, raid_movement, avatar, charge_movement, potion_of_the_old_war
0:20.906 auto_attack Fluffy_Pillow 31.2/130: 24% rage bloodlust, raid_movement, avatar, charge_movement, potion_of_the_old_war
0:20.906 mortal_strike Fluffy_Pillow 56.4/130: 43% rage bloodlust, raid_movement, avatar, charge_movement, potion_of_the_old_war
0:22.008 bladestorm Fluffy_Pillow 40.4/130: 31% rage bloodlust, potion_of_the_old_war
0:26.551 mortal_strike Fluffy_Pillow 90.8/130: 70% rage bloodlust
0:26.551 focused_rage Fluffy_Pillow 62.8/130: 48% rage bloodlust, focused_rage
0:27.647 focused_rage Fluffy_Pillow 50.8/130: 39% rage bloodlust, focused_rage(2)
0:27.651 colossus_smash Fluffy_Pillow 50.8/130: 39% rage bloodlust, focused_rage(2)
0:28.752 mortal_strike Fluffy_Pillow 50.8/130: 39% rage bloodlust, raid_movement, focused_rage(2), precise_strikes, shattered_defenses
0:29.852 mortal_strike Fluffy_Pillow 67.2/130: 52% rage bloodlust
0:30.952 colossus_smash Fluffy_Pillow 51.2/130: 39% rage bloodlust
0:31.452 focused_rage Fluffy_Pillow 64.4/130: 50% rage bloodlust, focused_rage, precise_strikes, shattered_defenses
0:32.053 battle_cry Fluffy_Pillow 64.4/130: 50% rage bloodlust, focused_rage, precise_strikes, shattered_defenses
0:32.053 heroic_leap Fluffy_Pillow 64.4/130: 50% rage bloodlust, corrupted_blood_of_zakajz, focused_rage, precise_strikes, battle_cry, shattered_defenses
0:32.053 cleave Fluffy_Pillow 64.4/130: 50% rage bloodlust, corrupted_blood_of_zakajz, focused_rage, precise_strikes, battle_cry, shattered_defenses
0:32.548 focused_rage Fluffy_Pillow 64.4/130: 50% rage bloodlust, cleave, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
0:33.153 whirlwind Fluffy_Pillow 64.4/130: 50% rage bloodlust, cleave, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
0:33.644 focused_rage Fluffy_Pillow 70.4/130: 54% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
0:34.253 mortal_strike Fluffy_Pillow 106.5/130: 82% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
0:34.740 focused_rage Fluffy_Pillow 106.5/130: 82% rage bloodlust, corrupted_blood_of_zakajz, focused_rage, battle_cry, acceleration
0:35.274 whirlwind Fluffy_Pillow 106.5/130: 82% rage bloodlust, corrupted_blood_of_zakajz, focused_rage, battle_cry, acceleration
0:35.693 focused_rage Fluffy_Pillow 112.5/130: 87% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(2), battle_cry, acceleration
0:36.232 cleave Fluffy_Pillow 112.5/130: 87% rage bloodlust, corrupted_blood_of_zakajz, focused_rage(2), battle_cry, acceleration
0:36.646 focused_rage Fluffy_Pillow 130.0/130: 100% rage bloodlust, cleave, corrupted_blood_of_zakajz, focused_rage(3), battle_cry, acceleration
0:37.189 whirlwind Fluffy_Pillow 130.0/130: 100% rage bloodlust, cleave, focused_rage(3), acceleration
0:38.145 mortal_strike Fluffy_Pillow 116.0/130: 89% rage bloodlust, focused_rage(3), acceleration
0:39.104 colossus_smash Fluffy_Pillow 125.2/130: 96% rage bloodlust, acceleration
0:39.104 focused_rage Fluffy_Pillow 113.2/130: 87% rage bloodlust, focused_rage, precise_strikes, shattered_defenses, acceleration
0:40.057 focused_rage Fluffy_Pillow 101.2/130: 78% rage bloodlust, focused_rage(2), precise_strikes, shattered_defenses, acceleration
0:40.061 slam Fluffy_Pillow 101.2/130: 78% rage bloodlust, focused_rage(2), precise_strikes, shattered_defenses, acceleration
0:41.013 focused_rage Fluffy_Pillow 73.2/130: 56% rage focused_rage(3), precise_strikes, shattered_defenses, acceleration
0:41.026 slam Fluffy_Pillow 98.4/130: 76% rage focused_rage(3), precise_strikes, shattered_defenses, acceleration
0:42.270 mortal_strike Fluffy_Pillow 82.4/130: 63% rage focused_rage(3), precise_strikes, shattered_defenses, acceleration
0:43.514 colossus_smash Fluffy_Pillow 73.6/130: 57% rage acceleration
0:43.514 focused_rage Fluffy_Pillow 61.6/130: 47% rage focused_rage, precise_strikes, shattered_defenses, acceleration
0:44.756 focused_rage Fluffy_Pillow 74.8/130: 58% rage raid_movement, focused_rage(2), precise_strikes, shattered_defenses
0:44.761 mortal_strike Fluffy_Pillow 74.8/130: 58% rage raid_movement, focused_rage(2), precise_strikes, shattered_defenses
0:46.181 focused_rage Fluffy_Pillow 54.0/130: 42% rage focused_rage
0:46.190 slam Fluffy_Pillow 54.0/130: 42% rage focused_rage
0:47.606 focused_rage Fluffy_Pillow 51.2/130: 39% rage focused_rage(2)
0:47.620 slam Fluffy_Pillow 51.2/130: 39% rage focused_rage(2)
0:49.048 slam Fluffy_Pillow 35.2/130: 27% rage focused_rage(2)
0:50.477 charge Fluffy_Pillow 19.2/130: 15% rage raid_movement, focused_rage(2)
0:50.477 Waiting 0.400 sec 39.2/130: 30% rage raid_movement, charge_movement, focused_rage(2)
0:50.877 auto_attack Fluffy_Pillow 39.2/130: 30% rage raid_movement, charge_movement, focused_rage(2)
0:50.877 mortal_strike Fluffy_Pillow 64.4/130: 50% rage raid_movement, charge_movement, focused_rage(2)
0:52.306 cleave Fluffy_Pillow 48.4/130: 37% rage
0:53.736 Waiting 0.600 sec 40.4/130: 31% rage cleave
0:54.336 whirlwind Fluffy_Pillow 65.6/130: 50% rage cleave
0:55.767 Waiting 0.600 sec 51.6/130: 40% rage
0:56.367 mortal_strike Fluffy_Pillow 51.6/130: 40% rage
0:57.778 focused_rage Fluffy_Pillow 48.8/130: 38% rage focused_rage
0:58.006 cleave Fluffy_Pillow 48.8/130: 38% rage focused_rage
0:59.439 Waiting 0.600 sec 40.8/130: 31% rage cleave, focused_rage
1:00.039 charge Fluffy_Pillow 40.8/130: 31% rage raid_movement, cleave, focused_rage
1:00.039 Waiting 0.200 sec 60.8/130: 47% rage raid_movement, cleave, charge_movement, focused_rage
1:00.239 whirlwind Fluffy_Pillow 60.8/130: 47% rage cleave, focused_rage
1:01.669 colossus_smash Fluffy_Pillow 72.0/130: 55% rage focused_rage
1:01.669 focused_rage Fluffy_Pillow 60.0/130: 46% rage focused_rage(2), precise_strikes, shattered_defenses
1:03.094 focused_rage Fluffy_Pillow 48.0/130: 37% rage focused_rage(3), precise_strikes, shattered_defenses
1:03.097 battle_cry Fluffy_Pillow 48.0/130: 37% rage focused_rage(3), precise_strikes, shattered_defenses
1:03.097 heroic_leap Fluffy_Pillow 48.0/130: 37% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
1:03.097 mortal_strike Fluffy_Pillow 48.0/130: 37% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
1:04.519 focused_rage Fluffy_Pillow 48.0/130: 37% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
1:04.527 colossus_smash Fluffy_Pillow 48.0/130: 37% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
1:05.944 focused_rage Fluffy_Pillow 85.7/130: 66% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, mark_of_the_heavy_hide
1:05.957 cleave Fluffy_Pillow 85.7/130: 66% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, mark_of_the_heavy_hide
1:07.369 focused_rage Fluffy_Pillow 85.7/130: 66% rage cleave, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, mark_of_the_heavy_hide
1:07.386 whirlwind Fluffy_Pillow 85.7/130: 66% rage cleave, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, mark_of_the_heavy_hide
1:08.814 mortal_strike Fluffy_Pillow 128.9/130: 99% rage focused_rage(3), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
1:08.814 focused_rage Fluffy_Pillow 108.1/130: 83% rage focused_rage, mark_of_the_heavy_hide
1:10.243 slam Fluffy_Pillow 108.1/130: 83% rage focused_rage, mark_of_the_heavy_hide
1:10.243 focused_rage Fluffy_Pillow 80.1/130: 62% rage focused_rage(2), mark_of_the_heavy_hide
1:11.668 focused_rage Fluffy_Pillow 93.3/130: 72% rage focused_rage(3), mark_of_the_heavy_hide
1:11.673 slam Fluffy_Pillow 93.3/130: 72% rage focused_rage(3), mark_of_the_heavy_hide
1:13.102 warbreaker Fluffy_Pillow 77.3/130: 59% rage focused_rage(3), mark_of_the_heavy_hide
1:14.532 mortal_strike Fluffy_Pillow 77.3/130: 59% rage focused_rage(3), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
1:14.532 focused_rage Fluffy_Pillow 56.5/130: 43% rage focused_rage, mark_of_the_heavy_hide
1:15.962 slam Fluffy_Pillow 81.7/130: 63% rage focused_rage, cleansed_wisps_blessing, mark_of_the_heavy_hide
1:15.962 focused_rage Fluffy_Pillow 53.7/130: 41% rage focused_rage(2), cleansed_wisps_blessing, mark_of_the_heavy_hide
1:17.391 slam Fluffy_Pillow 53.7/130: 41% rage focused_rage(2), cleansed_wisps_blessing, mark_of_the_heavy_hide
1:18.820 colossus_smash Fluffy_Pillow 74.5/130: 57% rage focused_rage(2), cleansed_wisps_blessing, mark_of_the_heavy_hide
1:18.820 focused_rage Fluffy_Pillow 62.5/130: 48% rage focused_rage(3), precise_strikes, shattered_defenses, cleansed_wisps_blessing, mark_of_the_heavy_hide
1:20.250 charge Fluffy_Pillow 62.5/130: 48% rage raid_movement, focused_rage(3), precise_strikes, shattered_defenses, cleansed_wisps_blessing, mark_of_the_heavy_hide
1:20.250 Waiting 0.500 sec 82.5/130: 63% rage raid_movement, charge_movement, focused_rage(3), precise_strikes, shattered_defenses, cleansed_wisps_blessing, mark_of_the_heavy_hide
1:20.750 mortal_strike Fluffy_Pillow 82.5/130: 63% rage raid_movement, charge_movement, focused_rage(3), precise_strikes, shattered_defenses, cleansed_wisps_blessing, mark_of_the_heavy_hide
1:20.750 focused_rage Fluffy_Pillow 61.7/130: 47% rage raid_movement, charge_movement, focused_rage, cleansed_wisps_blessing, mark_of_the_heavy_hide
1:22.179 cleave Fluffy_Pillow 86.9/130: 67% rage focused_rage, cleansed_wisps_blessing, mark_of_the_heavy_hide
1:22.179 focused_rage Fluffy_Pillow 66.9/130: 51% rage cleave, focused_rage(2), cleansed_wisps_blessing, mark_of_the_heavy_hide
1:23.604 focused_rage Fluffy_Pillow 54.9/130: 42% rage cleave, focused_rage(3), cleansed_wisps_blessing
1:23.609 Waiting 1.500 sec 54.9/130: 42% rage cleave, focused_rage(3), cleansed_wisps_blessing
1:25.109 whirlwind Fluffy_Pillow 80.1/130: 62% rage cleave, focused_rage(3)
1:26.538 mortal_strike Fluffy_Pillow 66.1/130: 51% rage focused_rage(3)
1:27.967 cleave Fluffy_Pillow 50.1/130: 39% rage
1:28.567 focused_rage Fluffy_Pillow 55.3/130: 43% rage cleave, focused_rage
1:29.397 Waiting 0.400 sec 55.3/130: 43% rage cleave, focused_rage
1:29.797 arcane_torrent Fluffy_Pillow 55.3/130: 43% rage cleave, focused_rage
1:30.000 whirlwind Fluffy_Pillow 70.3/130: 54% rage cleave, focused_rage
1:31.000 avatar Fluffy_Pillow 56.3/130: 43% rage avatar, focused_rage
1:31.428 colossus_smash Fluffy_Pillow 56.3/130: 43% rage avatar, focused_rage
1:32.528 focused_rage Fluffy_Pillow 69.5/130: 53% rage raid_movement, avatar, focused_rage(2), precise_strikes, shattered_defenses
1:32.858 heroic_leap Fluffy_Pillow 69.5/130: 53% rage raid_movement, avatar, focused_rage(2), precise_strikes, shattered_defenses
1:33.097 mortal_strike Fluffy_Pillow 69.5/130: 53% rage raid_movement, avatar, heroic_leap_movement, focused_rage(2), precise_strikes, shattered_defenses
1:33.953 focused_rage Fluffy_Pillow 48.7/130: 37% rage avatar, focused_rage
1:34.527 battle_cry Fluffy_Pillow 48.7/130: 37% rage avatar, focused_rage
1:34.527 cleave Fluffy_Pillow 48.7/130: 37% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry
1:35.378 focused_rage Fluffy_Pillow 85.3/130: 66% rage avatar, cleave, corrupted_blood_of_zakajz, focused_rage(2), battle_cry
1:35.955 whirlwind Fluffy_Pillow 85.3/130: 66% rage avatar, cleave, corrupted_blood_of_zakajz, focused_rage(2), battle_cry
1:36.803 focused_rage Fluffy_Pillow 91.3/130: 70% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
1:37.384 whirlwind Fluffy_Pillow 91.3/130: 70% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
1:38.228 focused_rage Fluffy_Pillow 97.3/130: 75% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
1:38.814 mortal_strike Fluffy_Pillow 130.0/130: 100% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), battle_cry
1:39.653 focused_rage Fluffy_Pillow 118.0/130: 91% rage avatar, focused_rage
1:40.242 slam Fluffy_Pillow 118.0/130: 91% rage avatar, focused_rage
1:41.671 colossus_smash Fluffy_Pillow 102.0/130: 78% rage avatar, focused_rage
1:41.671 focused_rage Fluffy_Pillow 90.0/130: 69% rage avatar, focused_rage(2), precise_strikes, shattered_defenses
1:43.096 focused_rage Fluffy_Pillow 103.2/130: 79% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
1:43.100 mortal_strike Fluffy_Pillow 103.2/130: 79% rage avatar, focused_rage(3), precise_strikes, shattered_defenses
1:44.528 colossus_smash Fluffy_Pillow 94.4/130: 73% rage avatar
1:44.528 focused_rage Fluffy_Pillow 82.4/130: 63% rage avatar, focused_rage, precise_strikes, shattered_defenses
1:45.953 focused_rage Fluffy_Pillow 95.6/130: 74% rage avatar, focused_rage(2), precise_strikes, shattered_defenses
1:45.958 mortal_strike Fluffy_Pillow 95.6/130: 74% rage avatar, focused_rage(2), precise_strikes, shattered_defenses
1:47.388 colossus_smash Fluffy_Pillow 86.8/130: 67% rage avatar
1:47.388 focused_rage Fluffy_Pillow 74.8/130: 58% rage avatar, focused_rage, precise_strikes, shattered_defenses
1:48.813 focused_rage Fluffy_Pillow 62.8/130: 48% rage raid_movement, avatar, focused_rage(2), precise_strikes, shattered_defenses
1:48.817 mortal_strike Fluffy_Pillow 62.8/130: 48% rage raid_movement, avatar, focused_rage(2), precise_strikes, shattered_defenses
1:50.247 charge Fluffy_Pillow 79.2/130: 61% rage raid_movement, avatar
1:50.247 Waiting 0.500 sec 99.2/130: 76% rage raid_movement, avatar, charge_movement
1:50.747 cleave Fluffy_Pillow 99.2/130: 76% rage raid_movement, avatar, charge_movement
1:50.747 focused_rage Fluffy_Pillow 79.2/130: 61% rage raid_movement, avatar, cleave, charge_movement, focused_rage
1:52.172 focused_rage Fluffy_Pillow 67.2/130: 52% rage cleave, focused_rage(2)
1:52.176 bladestorm Fluffy_Pillow 67.2/130: 52% rage cleave, focused_rage(2)
1:58.167 mortal_strike Fluffy_Pillow 117.6/130: 90% rage focused_rage(2), acceleration
1:58.167 focused_rage Fluffy_Pillow 89.6/130: 69% rage focused_rage, acceleration
1:59.332 focused_rage Fluffy_Pillow 114.8/130: 88% rage focused_rage(2), cleansed_sisters_blessing, acceleration
1:59.334 cleave Fluffy_Pillow 114.8/130: 88% rage focused_rage(2), cleansed_sisters_blessing, acceleration
2:00.495 focused_rage Fluffy_Pillow 94.8/130: 73% rage cleave, focused_rage(3), cleansed_sisters_blessing, acceleration
2:00.502 colossus_smash Fluffy_Pillow 94.8/130: 73% rage cleave, focused_rage(3), cleansed_sisters_blessing, acceleration
2:01.671 mortal_strike Fluffy_Pillow 120.0/130: 92% rage cleave, focused_rage(3), precise_strikes, shattered_defenses, cleansed_sisters_blessing, acceleration
2:01.671 focused_rage Fluffy_Pillow 99.2/130: 76% rage cleave, focused_rage, cleansed_sisters_blessing, acceleration
2:02.837 mortal_strike Fluffy_Pillow 99.2/130: 76% rage cleave, focused_rage, cleansed_sisters_blessing, acceleration
2:04.006 charge Fluffy_Pillow 83.2/130: 64% rage raid_movement, cleave, cleansed_sisters_blessing, acceleration
2:04.006 Waiting 0.100 sec 103.2/130: 79% rage raid_movement, cleave, charge_movement, cleansed_sisters_blessing, acceleration
2:04.106 colossus_smash Fluffy_Pillow 103.2/130: 79% rage raid_movement, cleave, charge_movement, cleansed_sisters_blessing, acceleration
2:04.106 focused_rage Fluffy_Pillow 91.2/130: 70% rage raid_movement, cleave, charge_movement, focused_rage, precise_strikes, shattered_defenses, cleansed_sisters_blessing, acceleration
2:05.302 focused_rage Fluffy_Pillow 104.4/130: 80% rage cleave, focused_rage(2), precise_strikes, shattered_defenses, cleansed_sisters_blessing
2:05.309 heroic_leap Fluffy_Pillow 104.4/130: 80% rage cleave, focused_rage(2), precise_strikes, shattered_defenses, cleansed_sisters_blessing
2:05.309 cleave Fluffy_Pillow 104.4/130: 80% rage cleave, focused_rage(2), precise_strikes, shattered_defenses, cleansed_sisters_blessing
2:06.627 focused_rage Fluffy_Pillow 84.4/130: 65% rage cleave(2), focused_rage(3), precise_strikes, shattered_defenses, cleansed_sisters_blessing
2:06.639 battle_cry Fluffy_Pillow 84.4/130: 65% rage cleave(2), focused_rage(3), precise_strikes, shattered_defenses, cleansed_sisters_blessing
2:06.639 whirlwind Fluffy_Pillow 84.4/130: 65% rage cleave(2), corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, cleansed_sisters_blessing
2:07.969 mortal_strike Fluffy_Pillow 126.9/130: 98% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, cleansed_sisters_blessing
2:07.969 focused_rage Fluffy_Pillow 126.9/130: 98% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, cleansed_sisters_blessing
2:09.382 colossus_smash Fluffy_Pillow 126.9/130: 98% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
2:09.382 focused_rage Fluffy_Pillow 126.9/130: 98% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses
2:10.807 focused_rage Fluffy_Pillow 130.0/130: 100% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
2:10.813 slam Fluffy_Pillow 130.0/130: 100% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
2:12.243 slam Fluffy_Pillow 130.0/130: 100% rage focused_rage(3), precise_strikes, shattered_defenses
2:13.673 mortal_strike Fluffy_Pillow 114.0/130: 88% rage focused_rage(3), precise_strikes, shattered_defenses
2:13.673 focused_rage Fluffy_Pillow 93.2/130: 72% rage focused_rage
2:15.101 slam Fluffy_Pillow 118.4/130: 91% rage focused_rage
2:15.101 focused_rage Fluffy_Pillow 90.4/130: 70% rage focused_rage(2)
2:16.526 focused_rage Fluffy_Pillow 78.4/130: 60% rage focused_rage(3)
2:16.531 slam Fluffy_Pillow 78.4/130: 60% rage focused_rage(3)
2:17.960 colossus_smash Fluffy_Pillow 87.6/130: 67% rage focused_rage(3), mark_of_the_heavy_hide
2:19.389 mortal_strike Fluffy_Pillow 87.6/130: 67% rage focused_rage(3), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
2:19.389 focused_rage Fluffy_Pillow 66.8/130: 51% rage focused_rage, mark_of_the_heavy_hide
2:20.819 warbreaker Fluffy_Pillow 66.8/130: 51% rage focused_rage, mark_of_the_heavy_hide
2:20.819 focused_rage Fluffy_Pillow 54.8/130: 42% rage focused_rage(2), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
2:22.244 focused_rage Fluffy_Pillow 80.1/130: 62% rage focused_rage(3), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
2:22.246 mortal_strike Fluffy_Pillow 80.1/130: 62% rage focused_rage(3), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
2:23.674 colossus_smash Fluffy_Pillow 71.3/130: 55% rage mark_of_the_heavy_hide
2:23.674 focused_rage Fluffy_Pillow 59.3/130: 46% rage focused_rage, precise_strikes, shattered_defenses, mark_of_the_heavy_hide
2:25.099 focused_rage Fluffy_Pillow 72.5/130: 56% rage focused_rage(2), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
2:25.102 cleave Fluffy_Pillow 72.5/130: 56% rage focused_rage(2), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
2:26.524 focused_rage Fluffy_Pillow 52.5/130: 40% rage cleave, focused_rage(3), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
2:26.531 mortal_strike Fluffy_Pillow 52.5/130: 40% rage cleave, focused_rage(3), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
2:27.961 colossus_smash Fluffy_Pillow 68.9/130: 53% rage cleave
2:27.961 focused_rage Fluffy_Pillow 56.9/130: 44% rage cleave, focused_rage, precise_strikes, shattered_defenses
2:29.391 Waiting 1.200 sec 56.9/130: 44% rage cleave, focused_rage, precise_strikes, shattered_defenses
2:30.591 cleave Fluffy_Pillow 56.9/130: 44% rage cleave, focused_rage, precise_strikes, shattered_defenses
2:31.303 focused_rage Fluffy_Pillow 62.1/130: 48% rage cleave(2), focused_rage(2), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
2:32.234 mortal_strike Fluffy_Pillow 62.1/130: 48% rage cleave(2), focused_rage(2), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
2:33.665 Waiting 1.100 sec 53.3/130: 41% rage cleave(2), mark_of_the_heavy_hide
2:34.765 whirlwind Fluffy_Pillow 78.5/130: 60% rage cleave(2), mark_of_the_heavy_hide
2:34.965 focused_rage Fluffy_Pillow 52.5/130: 40% rage cleave(2), focused_rage, mark_of_the_heavy_hide
2:36.194 Waiting 0.300 sec 52.5/130: 40% rage raid_movement, focused_rage, mark_of_the_heavy_hide
2:36.494 cleave Fluffy_Pillow 52.5/130: 40% rage raid_movement, focused_rage, mark_of_the_heavy_hide
2:37.935 colossus_smash Fluffy_Pillow 44.5/130: 34% rage cleave, focused_rage, mark_of_the_heavy_hide
2:38.135 focused_rage Fluffy_Pillow 57.7/130: 44% rage cleave, focused_rage(2), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
2:39.365 battle_cry Fluffy_Pillow 57.7/130: 44% rage cleave, focused_rage(2), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
2:39.365 heroic_leap Fluffy_Pillow 57.7/130: 44% rage cleave, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, mark_of_the_heavy_hide
2:39.365 focused_rage Fluffy_Pillow 57.7/130: 44% rage cleave, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, mark_of_the_heavy_hide
2:39.560 mortal_strike Fluffy_Pillow 57.7/130: 44% rage cleave, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, mark_of_the_heavy_hide
2:40.985 focused_rage Fluffy_Pillow 57.7/130: 44% rage cleave, corrupted_blood_of_zakajz, focused_rage, battle_cry, mark_of_the_heavy_hide
2:40.990 slam Fluffy_Pillow 57.7/130: 44% rage cleave, corrupted_blood_of_zakajz, focused_rage, battle_cry, mark_of_the_heavy_hide
2:42.410 focused_rage Fluffy_Pillow 94.9/130: 73% rage cleave, corrupted_blood_of_zakajz, focused_rage(2), battle_cry
2:42.419 colossus_smash Fluffy_Pillow 94.9/130: 73% rage cleave, corrupted_blood_of_zakajz, focused_rage(2), battle_cry
2:43.835 focused_rage Fluffy_Pillow 94.9/130: 73% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
2:43.848 mortal_strike Fluffy_Pillow 94.9/130: 73% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
2:45.277 colossus_smash Fluffy_Pillow 120.1/130: 92% rage
2:45.277 focused_rage Fluffy_Pillow 108.1/130: 83% rage focused_rage, precise_strikes, shattered_defenses
2:46.702 focused_rage Fluffy_Pillow 96.1/130: 74% rage focused_rage(2), precise_strikes, shattered_defenses
2:46.708 slam Fluffy_Pillow 96.1/130: 74% rage focused_rage(2), precise_strikes, shattered_defenses
2:48.127 focused_rage Fluffy_Pillow 68.1/130: 52% rage focused_rage(3), precise_strikes, shattered_defenses
2:48.138 mortal_strike Fluffy_Pillow 68.1/130: 52% rage focused_rage(3), precise_strikes, shattered_defenses
2:49.567 colossus_smash Fluffy_Pillow 84.5/130: 65% rage
2:49.567 focused_rage Fluffy_Pillow 72.5/130: 56% rage focused_rage, precise_strikes, shattered_defenses
2:50.998 charge Fluffy_Pillow 72.5/130: 56% rage raid_movement, focused_rage, precise_strikes, shattered_defenses
2:50.998 Waiting 0.400 sec 92.5/130: 71% rage raid_movement, charge_movement, focused_rage, precise_strikes, shattered_defenses
2:51.398 cleave Fluffy_Pillow 92.5/130: 71% rage charge_movement, focused_rage, precise_strikes, shattered_defenses
2:51.398 focused_rage Fluffy_Pillow 72.5/130: 56% rage cleave, charge_movement, focused_rage(2), precise_strikes, shattered_defenses
2:52.823 focused_rage Fluffy_Pillow 85.7/130: 66% rage cleave, focused_rage(3), precise_strikes, shattered_defenses
2:52.828 whirlwind Fluffy_Pillow 85.7/130: 66% rage cleave, focused_rage(3), precise_strikes, shattered_defenses
2:54.258 mortal_strike Fluffy_Pillow 71.7/130: 55% rage focused_rage(3), precise_strikes, shattered_defenses
2:54.258 focused_rage Fluffy_Pillow 50.9/130: 39% rage focused_rage
2:55.687 whirlwind Fluffy_Pillow 76.1/130: 59% rage focused_rage
2:55.887 focused_rage Fluffy_Pillow 50.1/130: 39% rage focused_rage(2)
2:56.983 mortal_strike Fluffy_Pillow 50.1/130: 39% rage focused_rage(2), acceleration
2:58.227 colossus_smash Fluffy_Pillow 34.1/130: 26% rage acceleration
2:59.471 cleave Fluffy_Pillow 59.3/130: 46% rage precise_strikes, shattered_defenses, acceleration
3:00.717 arcane_torrent Fluffy_Pillow 51.3/130: 39% rage cleave, precise_strikes, shattered_defenses, acceleration
3:00.717 mortal_strike Fluffy_Pillow 66.3/130: 51% rage cleave, precise_strikes, shattered_defenses, acceleration
3:01.000 avatar Fluffy_Pillow 57.5/130: 44% rage avatar, cleave, acceleration
3:01.962 colossus_smash Fluffy_Pillow 82.7/130: 64% rage avatar, cleave, acceleration
3:01.962 focused_rage Fluffy_Pillow 70.7/130: 54% rage avatar, cleave, focused_rage, precise_strikes, shattered_defenses, acceleration
3:03.202 focused_rage Fluffy_Pillow 58.7/130: 45% rage avatar, cleave, focused_rage(2), precise_strikes, shattered_defenses, acceleration
3:03.208 Waiting 1.000 sec 58.7/130: 45% rage avatar, cleave, focused_rage(2), precise_strikes, shattered_defenses, acceleration
3:04.208 cleave Fluffy_Pillow 58.7/130: 45% rage avatar, cleave, focused_rage(2), precise_strikes, shattered_defenses, acceleration
3:04.442 focused_rage Fluffy_Pillow 63.9/130: 49% rage avatar, cleave(2), focused_rage(3), precise_strikes, shattered_defenses, acceleration
3:05.677 mortal_strike Fluffy_Pillow 63.9/130: 49% rage avatar, cleave(2), focused_rage(3), precise_strikes, shattered_defenses, acceleration
3:07.046 Waiting 0.400 sec 55.1/130: 42% rage avatar, cleave(2), cleansed_wisps_blessing
3:07.446 whirlwind Fluffy_Pillow 80.3/130: 62% rage avatar, cleave(2), cleansed_wisps_blessing
3:08.877 mortal_strike Fluffy_Pillow 66.3/130: 51% rage raid_movement, avatar, cleansed_wisps_blessing
3:10.307 colossus_smash Fluffy_Pillow 50.3/130: 39% rage avatar, cleansed_wisps_blessing
3:10.807 focused_rage Fluffy_Pillow 63.5/130: 49% rage avatar, focused_rage, precise_strikes, shattered_defenses, cleansed_ancients_blessing, cleansed_wisps_blessing
3:11.736 battle_cry Fluffy_Pillow 63.5/130: 49% rage avatar, focused_rage, precise_strikes, shattered_defenses, cleansed_ancients_blessing, cleansed_wisps_blessing
3:11.736 heroic_leap Fluffy_Pillow 63.5/130: 49% rage avatar, corrupted_blood_of_zakajz, focused_rage, precise_strikes, battle_cry, shattered_defenses, cleansed_ancients_blessing, cleansed_wisps_blessing
3:11.736 slam Fluffy_Pillow 63.5/130: 49% rage avatar, corrupted_blood_of_zakajz, focused_rage, precise_strikes, battle_cry, shattered_defenses, cleansed_ancients_blessing, cleansed_wisps_blessing
3:12.232 focused_rage Fluffy_Pillow 63.5/130: 49% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, cleansed_ancients_blessing, cleansed_wisps_blessing
3:13.167 slam Fluffy_Pillow 63.5/130: 49% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, cleansed_ancients_blessing, cleansed_wisps_blessing
3:13.624 focused_rage Fluffy_Pillow 63.5/130: 49% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, cleansed_ancients_blessing, cleansed_sisters_blessing, cleansed_wisps_blessing
3:14.496 mortal_strike Fluffy_Pillow 100.7/130: 77% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, cleansed_ancients_blessing, cleansed_sisters_blessing, cleansed_wisps_blessing
3:14.949 focused_rage Fluffy_Pillow 100.7/130: 77% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, cleansed_ancients_blessing, cleansed_sisters_blessing, cleansed_wisps_blessing
3:15.825 mortal_strike Fluffy_Pillow 100.7/130: 77% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, cleansed_ancients_blessing, cleansed_sisters_blessing
3:16.274 focused_rage Fluffy_Pillow 100.7/130: 77% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, cleansed_ancients_blessing, cleansed_sisters_blessing
3:17.155 colossus_smash Fluffy_Pillow 100.7/130: 77% rage avatar, focused_rage, cleansed_ancients_blessing, cleansed_sisters_blessing
3:17.599 focused_rage Fluffy_Pillow 113.9/130: 88% rage avatar, focused_rage(2), precise_strikes, shattered_defenses, cleansed_ancients_blessing, cleansed_sisters_blessing
3:18.484 mortal_strike Fluffy_Pillow 113.9/130: 88% rage avatar, focused_rage(2), precise_strikes, shattered_defenses, cleansed_ancients_blessing, cleansed_sisters_blessing
3:19.812 colossus_smash Fluffy_Pillow 105.1/130: 81% rage avatar, cleansed_ancients_blessing, cleansed_sisters_blessing
3:19.812 focused_rage Fluffy_Pillow 93.1/130: 72% rage avatar, focused_rage, precise_strikes, shattered_defenses, cleansed_ancients_blessing, cleansed_sisters_blessing
3:21.141 charge Fluffy_Pillow 93.1/130: 72% rage raid_movement, focused_rage, precise_strikes, shattered_defenses, cleansed_sisters_blessing
3:21.141 Waiting 0.300 sec 113.1/130: 87% rage raid_movement, charge_movement, focused_rage, precise_strikes, shattered_defenses, cleansed_sisters_blessing
3:21.441 auto_attack Fluffy_Pillow 113.1/130: 87% rage raid_movement, charge_movement, focused_rage, precise_strikes, shattered_defenses, cleansed_sisters_blessing
3:21.441 cleave Fluffy_Pillow 130.0/130: 100% rage raid_movement, charge_movement, focused_rage, precise_strikes, shattered_defenses, cleansed_sisters_blessing
3:21.441 focused_rage Fluffy_Pillow 110.0/130: 85% rage raid_movement, cleave, charge_movement, focused_rage(2), precise_strikes, shattered_defenses, cleansed_sisters_blessing
3:22.766 focused_rage Fluffy_Pillow 98.0/130: 75% rage cleave, focused_rage(3), precise_strikes, shattered_defenses, cleansed_sisters_blessing
3:22.768 bladestorm Fluffy_Pillow 98.0/130: 75% rage cleave, focused_rage(3), precise_strikes, shattered_defenses, cleansed_sisters_blessing
3:28.383 warbreaker Fluffy_Pillow 130.0/130: 100% rage focused_rage(3), precise_strikes, shattered_defenses
3:29.813 mortal_strike Fluffy_Pillow 130.0/130: 100% rage focused_rage(3), precise_strikes, shattered_defenses
3:29.813 focused_rage Fluffy_Pillow 109.2/130: 84% rage focused_rage
3:31.241 cleave Fluffy_Pillow 109.2/130: 84% rage focused_rage
3:31.241 focused_rage Fluffy_Pillow 89.2/130: 69% rage cleave, focused_rage(2)
3:32.666 focused_rage Fluffy_Pillow 102.4/130: 79% rage cleave, focused_rage(3)
3:32.670 whirlwind Fluffy_Pillow 102.4/130: 79% rage cleave, focused_rage(3)
3:34.099 whirlwind Fluffy_Pillow 88.4/130: 68% rage focused_rage(3)
3:35.528 mortal_strike Fluffy_Pillow 99.6/130: 77% rage focused_rage(3)
3:36.957 colossus_smash Fluffy_Pillow 83.6/130: 64% rage
3:36.957 focused_rage Fluffy_Pillow 71.6/130: 55% rage focused_rage, precise_strikes, shattered_defenses, mark_of_the_heavy_hide
3:38.382 focused_rage Fluffy_Pillow 59.6/130: 46% rage focused_rage(2), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
3:38.387 cleave Fluffy_Pillow 59.6/130: 46% rage focused_rage(2), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
3:39.807 focused_rage Fluffy_Pillow 77.2/130: 59% rage cleave, focused_rage(3), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
3:39.815 mortal_strike Fluffy_Pillow 77.2/130: 59% rage cleave, focused_rage(3), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
3:41.246 colossus_smash Fluffy_Pillow 68.4/130: 53% rage cleave, mark_of_the_heavy_hide
3:41.246 focused_rage Fluffy_Pillow 56.4/130: 43% rage cleave, focused_rage, precise_strikes, shattered_defenses, mark_of_the_heavy_hide
3:42.671 focused_rage Fluffy_Pillow 81.8/130: 63% rage cleave, focused_rage(2), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
3:42.677 heroic_leap Fluffy_Pillow 81.8/130: 63% rage cleave, focused_rage(2), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
3:42.677 slam Fluffy_Pillow 81.8/130: 63% rage cleave, focused_rage(2), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
3:44.096 focused_rage Fluffy_Pillow 53.8/130: 41% rage cleave, focused_rage(3), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
3:44.106 battle_cry Fluffy_Pillow 53.8/130: 41% rage cleave, focused_rage(3), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
3:44.106 slam Fluffy_Pillow 53.8/130: 41% rage cleave, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, mark_of_the_heavy_hide
3:45.521 focused_rage Fluffy_Pillow 90.7/130: 70% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, mark_of_the_heavy_hide
3:45.538 mortal_strike Fluffy_Pillow 90.7/130: 70% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, mark_of_the_heavy_hide
3:46.946 focused_rage Fluffy_Pillow 90.7/130: 70% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, mark_of_the_heavy_hide
3:46.967 slam Fluffy_Pillow 90.7/130: 70% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, mark_of_the_heavy_hide
3:48.371 focused_rage Fluffy_Pillow 90.7/130: 70% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry, mark_of_the_heavy_hide
3:48.396 mortal_strike Fluffy_Pillow 90.7/130: 70% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry, mark_of_the_heavy_hide
3:49.825 colossus_smash Fluffy_Pillow 127.1/130: 98% rage mark_of_the_heavy_hide
3:49.825 focused_rage Fluffy_Pillow 115.1/130: 89% rage focused_rage, precise_strikes, shattered_defenses, mark_of_the_heavy_hide
3:51.255 charge Fluffy_Pillow 115.1/130: 89% rage raid_movement, focused_rage, precise_strikes, shattered_defenses, mark_of_the_heavy_hide
3:51.255 Waiting 0.300 sec 130.0/130: 100% rage raid_movement, charge_movement, focused_rage, precise_strikes, shattered_defenses, mark_of_the_heavy_hide
3:51.555 cleave Fluffy_Pillow 130.0/130: 100% rage raid_movement, charge_movement, focused_rage, precise_strikes, shattered_defenses, mark_of_the_heavy_hide
3:51.555 focused_rage Fluffy_Pillow 110.0/130: 85% rage raid_movement, cleave, charge_movement, focused_rage(2), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
3:52.980 focused_rage Fluffy_Pillow 118.0/130: 91% rage cleave, focused_rage(3), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
3:52.985 whirlwind Fluffy_Pillow 118.0/130: 91% rage cleave, focused_rage(3), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
3:54.416 mortal_strike Fluffy_Pillow 104.0/130: 80% rage focused_rage(3), precise_strikes, shattered_defenses
3:54.416 focused_rage Fluffy_Pillow 83.2/130: 64% rage focused_rage
3:55.847 whirlwind Fluffy_Pillow 108.4/130: 83% rage focused_rage
3:57.276 mortal_strike Fluffy_Pillow 94.4/130: 73% rage focused_rage
3:58.706 colossus_smash Fluffy_Pillow 78.4/130: 60% rage
3:58.706 focused_rage Fluffy_Pillow 66.4/130: 51% rage focused_rage, precise_strikes, shattered_defenses, mark_of_the_heavy_hide
4:00.131 focused_rage Fluffy_Pillow 79.6/130: 61% rage focused_rage(2), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
4:00.134 cleave Fluffy_Pillow 79.6/130: 61% rage focused_rage(2), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
4:01.556 focused_rage Fluffy_Pillow 59.6/130: 46% rage cleave, focused_rage(3), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
4:01.562 Waiting 0.800 sec 59.6/130: 46% rage cleave, focused_rage(3), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
4:02.362 whirlwind Fluffy_Pillow 84.8/130: 65% rage cleave, focused_rage(3), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
4:03.792 mortal_strike Fluffy_Pillow 70.8/130: 54% rage focused_rage(3), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
4:05.221 colossus_smash Fluffy_Pillow 62.0/130: 48% rage mark_of_the_heavy_hide
4:05.221 focused_rage Fluffy_Pillow 50.0/130: 38% rage focused_rage, precise_strikes, shattered_defenses, mark_of_the_heavy_hide
4:06.646 focused_rage Fluffy_Pillow 63.2/130: 49% rage focused_rage(2), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
4:06.651 mortal_strike Fluffy_Pillow 63.2/130: 49% rage focused_rage(2), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
4:08.082 colossus_smash Fluffy_Pillow 54.4/130: 42% rage mark_of_the_heavy_hide
4:09.282 focused_rage Fluffy_Pillow 67.6/130: 52% rage focused_rage, precise_strikes, shattered_defenses
4:09.512 cleave Fluffy_Pillow 67.6/130: 52% rage focused_rage, precise_strikes, shattered_defenses
4:10.942 slam Fluffy_Pillow 59.6/130: 46% rage cleave, focused_rage, precise_strikes, shattered_defenses
4:12.370 Waiting 0.100 sec 43.6/130: 34% rage raid_movement, cleave, focused_rage, precise_strikes, shattered_defenses, mark_of_the_heavy_hide
4:12.470 heroic_leap Fluffy_Pillow 43.6/130: 34% rage raid_movement, cleave, focused_rage, precise_strikes, shattered_defenses, mark_of_the_heavy_hide
4:12.677 focused_rage Fluffy_Pillow 68.8/130: 53% rage raid_movement, cleave, heroic_leap_movement, focused_rage, precise_strikes, shattered_defenses, cleansed_ancients_blessing, mark_of_the_heavy_hide
4:12.677 mortal_strike Fluffy_Pillow 56.8/130: 44% rage raid_movement, cleave, heroic_leap_movement, focused_rage(2), precise_strikes, shattered_defenses, cleansed_ancients_blessing, mark_of_the_heavy_hide
4:14.108 slam Fluffy_Pillow 48.0/130: 37% rage cleave, cleansed_ancients_blessing, mark_of_the_heavy_hide
4:15.536 battle_cry Fluffy_Pillow 32.0/130: 25% rage cleansed_ancients_blessing, mark_of_the_heavy_hide
4:15.536 focused_rage Fluffy_Pillow 32.0/130: 25% rage corrupted_blood_of_zakajz, battle_cry, cleansed_ancients_blessing, mark_of_the_heavy_hide
4:15.536 slam Fluffy_Pillow 32.0/130: 25% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, cleansed_ancients_blessing, mark_of_the_heavy_hide
4:16.961 focused_rage Fluffy_Pillow 69.2/130: 53% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry, cleansed_ancients_blessing, mark_of_the_heavy_hide
4:16.964 slam Fluffy_Pillow 69.2/130: 53% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry, cleansed_ancients_blessing, mark_of_the_heavy_hide
4:18.386 focused_rage Fluffy_Pillow 69.2/130: 53% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry, cleansed_ancients_blessing, mark_of_the_heavy_hide
4:18.392 mortal_strike Fluffy_Pillow 69.2/130: 53% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry, cleansed_ancients_blessing, mark_of_the_heavy_hide
4:19.713 focused_rage Fluffy_Pillow 105.7/130: 81% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, cleansed_ancients_blessing, cleansed_sisters_blessing, mark_of_the_heavy_hide
4:19.723 slam Fluffy_Pillow 105.7/130: 81% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, cleansed_ancients_blessing, cleansed_sisters_blessing, mark_of_the_heavy_hide
4:21.052 charge Fluffy_Pillow 105.7/130: 81% rage raid_movement, focused_rage, cleansed_ancients_blessing, cleansed_sisters_blessing
4:21.052 Waiting 0.400 sec 125.7/130: 97% rage raid_movement, charge_movement, focused_rage, cleansed_ancients_blessing, cleansed_sisters_blessing
4:21.452 cleave Fluffy_Pillow 125.7/130: 97% rage charge_movement, focused_rage, cleansed_ancients_blessing, cleansed_sisters_blessing
4:22.781 colossus_smash Fluffy_Pillow 130.0/130: 100% rage cleave, focused_rage, cleansed_sisters_blessing
4:22.781 focused_rage Fluffy_Pillow 118.0/130: 91% rage cleave, focused_rage(2), precise_strikes, shattered_defenses, cleansed_sisters_blessing
4:24.106 focused_rage Fluffy_Pillow 106.0/130: 82% rage cleave, focused_rage(3), precise_strikes, shattered_defenses, cleansed_sisters_blessing, mark_of_the_heavy_hide
4:24.110 mortal_strike Fluffy_Pillow 106.0/130: 82% rage cleave, focused_rage(3), precise_strikes, shattered_defenses, cleansed_sisters_blessing, mark_of_the_heavy_hide
4:25.431 focused_rage Fluffy_Pillow 85.2/130: 66% rage cleave, focused_rage, cleansed_sisters_blessing, mark_of_the_heavy_hide
4:25.441 whirlwind Fluffy_Pillow 85.2/130: 66% rage cleave, focused_rage, cleansed_sisters_blessing, mark_of_the_heavy_hide
4:26.756 focused_rage Fluffy_Pillow 84.4/130: 65% rage focused_rage(2), cleansed_sisters_blessing, mark_of_the_heavy_hide
4:26.771 cleave Fluffy_Pillow 84.4/130: 65% rage focused_rage(2), cleansed_sisters_blessing, mark_of_the_heavy_hide
4:28.101 Waiting 0.100 sec 76.4/130: 59% rage raid_movement, cleave, focused_rage(2), cleansed_sisters_blessing, mark_of_the_heavy_hide
4:28.201 warbreaker Fluffy_Pillow 76.4/130: 59% rage raid_movement, cleave, focused_rage(2), cleansed_sisters_blessing, mark_of_the_heavy_hide
4:28.483 focused_rage Fluffy_Pillow 64.4/130: 50% rage raid_movement, cleave, focused_rage(3), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
4:29.808 mortal_strike Fluffy_Pillow 89.6/130: 69% rage cleave, focused_rage(3), precise_strikes, shattered_defenses, mark_of_the_heavy_hide
4:31.000 avatar Fluffy_Pillow 80.8/130: 62% rage avatar, cleave, mark_of_the_heavy_hide
4:31.237 arcane_torrent Fluffy_Pillow 80.8/130: 62% rage avatar, cleave, mark_of_the_heavy_hide
4:31.237 mortal_strike Fluffy_Pillow 95.8/130: 74% rage avatar, cleave, mark_of_the_heavy_hide
4:32.668 mortal_strike Fluffy_Pillow 116.2/130: 89% rage avatar, cleave, mark_of_the_heavy_hide
4:34.098 colossus_smash Fluffy_Pillow 100.2/130: 77% rage avatar, mark_of_the_heavy_hide
4:34.098 focused_rage Fluffy_Pillow 88.2/130: 68% rage avatar, focused_rage, precise_strikes, shattered_defenses, mark_of_the_heavy_hide
4:35.523 focused_rage Fluffy_Pillow 76.2/130: 59% rage avatar, focused_rage(2), precise_strikes, shattered_defenses
4:35.529 mortal_strike Fluffy_Pillow 76.2/130: 59% rage avatar, focused_rage(2), precise_strikes, shattered_defenses
4:36.959 mortal_strike Fluffy_Pillow 104.6/130: 80% rage avatar
4:38.386 colossus_smash Fluffy_Pillow 88.6/130: 68% rage avatar
4:38.386 focused_rage Fluffy_Pillow 76.6/130: 59% rage avatar, focused_rage, precise_strikes, shattered_defenses
4:39.811 focused_rage Fluffy_Pillow 89.8/130: 69% rage avatar, focused_rage(2), precise_strikes, shattered_defenses
4:39.815 cleave Fluffy_Pillow 89.8/130: 69% rage avatar, focused_rage(2), precise_strikes, shattered_defenses
4:41.236 focused_rage Fluffy_Pillow 69.8/130: 54% rage avatar, cleave, focused_rage(3), precise_strikes, shattered_defenses
4:41.245 slam Fluffy_Pillow 69.8/130: 54% rage avatar, cleave, focused_rage(3), precise_strikes, shattered_defenses
4:42.672 heroic_leap Fluffy_Pillow 79.0/130: 61% rage avatar, cleave, focused_rage(3), precise_strikes, shattered_defenses, acceleration
4:42.677 mortal_strike Fluffy_Pillow 79.0/130: 61% rage avatar, cleave, focused_rage(3), precise_strikes, shattered_defenses, acceleration
4:42.677 focused_rage Fluffy_Pillow 58.2/130: 45% rage avatar, cleave, focused_rage, acceleration
4:43.924 colossus_smash Fluffy_Pillow 58.2/130: 45% rage avatar, cleave, focused_rage, acceleration
4:45.170 mortal_strike Fluffy_Pillow 58.2/130: 45% rage avatar, cleave, focused_rage, precise_strikes, shattered_defenses, acceleration
4:45.670 focused_rage Fluffy_Pillow 62.6/130: 48% rage avatar, cleave, focused_rage, mark_of_the_heavy_hide, acceleration
4:46.415 battle_cry Fluffy_Pillow 62.6/130: 48% rage avatar, focused_rage, mark_of_the_heavy_hide, acceleration
4:46.415 slam Fluffy_Pillow 62.6/130: 48% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, mark_of_the_heavy_hide, acceleration
4:46.910 focused_rage Fluffy_Pillow 62.6/130: 48% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry, mark_of_the_heavy_hide, acceleration
4:47.661 colossus_smash Fluffy_Pillow 62.6/130: 48% rage avatar, corrupted_blood_of_zakajz, focused_rage(2), battle_cry, mark_of_the_heavy_hide, acceleration
4:48.150 focused_rage Fluffy_Pillow 62.6/130: 48% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, mark_of_the_heavy_hide, acceleration
4:48.905 mortal_strike Fluffy_Pillow 99.0/130: 76% rage avatar, corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, mark_of_the_heavy_hide, acceleration
4:49.390 focused_rage Fluffy_Pillow 99.0/130: 76% rage avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, mark_of_the_heavy_hide, acceleration
4:50.149 charge Fluffy_Pillow 99.0/130: 76% rage raid_movement, avatar, corrupted_blood_of_zakajz, focused_rage, battle_cry, mark_of_the_heavy_hide, acceleration
4:50.149 Waiting 0.500 sec 119.0/130: 92% rage raid_movement, avatar, corrupted_blood_of_zakajz, charge_movement, focused_rage, battle_cry, mark_of_the_heavy_hide, acceleration
4:50.649 colossus_smash Fluffy_Pillow 119.0/130: 92% rage raid_movement, avatar, corrupted_blood_of_zakajz, charge_movement, focused_rage, battle_cry, mark_of_the_heavy_hide, acceleration
4:50.649 focused_rage Fluffy_Pillow 119.0/130: 92% rage raid_movement, avatar, corrupted_blood_of_zakajz, charge_movement, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, mark_of_the_heavy_hide, acceleration
4:51.889 focused_rage Fluffy_Pillow 118.0/130: 91% rage focused_rage(3), precise_strikes, shattered_defenses, mark_of_the_heavy_hide, acceleration
4:51.893 cleave Fluffy_Pillow 118.0/130: 91% rage focused_rage(3), precise_strikes, shattered_defenses, mark_of_the_heavy_hide, acceleration
4:53.136 mortal_strike Fluffy_Pillow 110.0/130: 85% rage cleave, focused_rage(3), precise_strikes, shattered_defenses, mark_of_the_heavy_hide, acceleration
4:54.380 colossus_smash Fluffy_Pillow 101.2/130: 78% rage cleave, mark_of_the_heavy_hide, acceleration
4:54.380 focused_rage Fluffy_Pillow 89.2/130: 69% rage cleave, focused_rage, precise_strikes, shattered_defenses, mark_of_the_heavy_hide, acceleration
4:55.620 focused_rage Fluffy_Pillow 102.4/130: 79% rage cleave, focused_rage(2), precise_strikes, shattered_defenses, mark_of_the_heavy_hide, acceleration
4:55.625 bladestorm Fluffy_Pillow 102.4/130: 79% rage cleave, focused_rage(2), precise_strikes, shattered_defenses, mark_of_the_heavy_hide, acceleration
5:00.779 mortal_strike Fluffy_Pillow 130.0/130: 100% rage raid_movement, focused_rage(2), precise_strikes, shattered_defenses, cleansed_wisps_blessing
5:00.779 focused_rage Fluffy_Pillow 109.2/130: 84% rage raid_movement, focused_rage, cleansed_wisps_blessing
5:02.208 cleave Fluffy_Pillow 109.2/130: 84% rage focused_rage, cleansed_wisps_blessing
5:02.208 focused_rage Fluffy_Pillow 89.2/130: 69% rage cleave, focused_rage(2), cleansed_wisps_blessing
5:03.639 colossus_smash Fluffy_Pillow 89.2/130: 69% rage cleave, focused_rage(2), cleansed_wisps_blessing
5:03.639 focused_rage Fluffy_Pillow 77.2/130: 59% rage cleave, focused_rage(3), precise_strikes, shattered_defenses, cleansed_wisps_blessing
5:05.069 mortal_strike Fluffy_Pillow 102.4/130: 79% rage cleave, focused_rage(3), precise_strikes, shattered_defenses, cleansed_ancients_blessing, cleansed_wisps_blessing
5:06.500 mortal_strike Fluffy_Pillow 93.6/130: 72% rage cleave, cleansed_ancients_blessing, cleansed_wisps_blessing
5:07.929 colossus_smash Fluffy_Pillow 114.0/130: 88% rage cleave, cleansed_ancients_blessing, cleansed_wisps_blessing
5:07.929 focused_rage Fluffy_Pillow 102.0/130: 78% rage cleave, focused_rage, precise_strikes, shattered_defenses, cleansed_ancients_blessing, cleansed_wisps_blessing
5:09.354 focused_rage Fluffy_Pillow 90.0/130: 69% rage focused_rage(2), precise_strikes, shattered_defenses, cleansed_ancients_blessing, cleansed_wisps_blessing
5:09.357 cleave Fluffy_Pillow 90.0/130: 69% rage focused_rage(2), precise_strikes, shattered_defenses, cleansed_ancients_blessing, cleansed_wisps_blessing
5:10.779 focused_rage Fluffy_Pillow 70.0/130: 54% rage cleave, focused_rage(3), precise_strikes, shattered_defenses, cleansed_ancients_blessing
5:10.787 slam Fluffy_Pillow 70.0/130: 54% rage cleave, focused_rage(3), precise_strikes, shattered_defenses, cleansed_ancients_blessing
5:12.217 mortal_strike Fluffy_Pillow 79.2/130: 61% rage cleave, focused_rage(3), precise_strikes, shattered_defenses, cleansed_ancients_blessing, cleansed_wisps_blessing, mark_of_the_heavy_hide
5:12.217 focused_rage Fluffy_Pillow 58.4/130: 45% rage cleave, focused_rage, cleansed_ancients_blessing, cleansed_wisps_blessing, mark_of_the_heavy_hide
5:13.646 heroic_leap Fluffy_Pillow 58.4/130: 45% rage cleave, focused_rage, cleansed_ancients_blessing, cleansed_wisps_blessing, mark_of_the_heavy_hide
5:13.646 slam Fluffy_Pillow 58.4/130: 45% rage cleave, focused_rage, cleansed_ancients_blessing, cleansed_wisps_blessing, mark_of_the_heavy_hide
5:15.076 colossus_smash Fluffy_Pillow 67.6/130: 52% rage cleave, focused_rage, cleansed_wisps_blessing, mark_of_the_heavy_hide
5:15.076 focused_rage Fluffy_Pillow 55.6/130: 43% rage cleave, focused_rage(2), precise_strikes, shattered_defenses, cleansed_wisps_blessing, mark_of_the_heavy_hide
5:16.505 mortal_strike Fluffy_Pillow 55.6/130: 43% rage raid_movement, focused_rage(2), precise_strikes, shattered_defenses, cleansed_wisps_blessing, mark_of_the_heavy_hide
5:17.705 focused_rage Fluffy_Pillow 60.0/130: 46% rage focused_rage, cleansed_wisps_blessing, mark_of_the_heavy_hide
5:17.934 slam Fluffy_Pillow 60.0/130: 46% rage focused_rage, cleansed_wisps_blessing, mark_of_the_heavy_hide
5:19.363 colossus_smash Fluffy_Pillow 44.0/130: 34% rage focused_rage, cleansed_wisps_blessing, mark_of_the_heavy_hide
5:20.792 battle_cry Fluffy_Pillow 44.0/130: 34% rage focused_rage, precise_strikes, shattered_defenses, cleansed_wisps_blessing, mark_of_the_heavy_hide
5:20.792 focused_rage Fluffy_Pillow 44.0/130: 34% rage corrupted_blood_of_zakajz, focused_rage, precise_strikes, battle_cry, shattered_defenses, cleansed_wisps_blessing, mark_of_the_heavy_hide
5:20.792 mortal_strike Fluffy_Pillow 44.0/130: 34% rage corrupted_blood_of_zakajz, focused_rage(2), precise_strikes, battle_cry, shattered_defenses, cleansed_wisps_blessing, mark_of_the_heavy_hide
5:22.217 focused_rage Fluffy_Pillow 80.6/130: 62% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, mark_of_the_heavy_hide
5:22.222 slam Fluffy_Pillow 80.6/130: 62% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, mark_of_the_heavy_hide
5:23.642 focused_rage Fluffy_Pillow 80.6/130: 62% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry, mark_of_the_heavy_hide
5:23.650 colossus_smash Fluffy_Pillow 80.6/130: 62% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry, mark_of_the_heavy_hide
5:25.067 focused_rage Fluffy_Pillow 118.0/130: 91% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, mark_of_the_heavy_hide
5:25.079 mortal_strike Fluffy_Pillow 118.0/130: 91% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses, mark_of_the_heavy_hide
5:26.509 execute Fluffy_Pillow 118.0/130: 91% rage mark_of_the_heavy_hide
5:27.936 colossus_smash Fluffy_Pillow 111.2/130: 86% rage mark_of_the_heavy_hide
5:29.365 execute Fluffy_Pillow 111.2/130: 86% rage precise_strikes, shattered_defenses
5:30.794 execute Fluffy_Pillow 93.6/130: 72% rage
5:32.223 Waiting 0.300 sec 86.8/130: 67% rage raid_movement
5:32.523 execute Fluffy_Pillow 86.8/130: 67% rage raid_movement
5:33.952 execute Fluffy_Pillow 54.8/130: 42% rage cleansed_wisps_blessing
5:35.381 execute Fluffy_Pillow 48.0/130: 37% rage cleansed_wisps_blessing
5:36.810 warbreaker Fluffy_Pillow 16.0/130: 12% rage cleansed_wisps_blessing
5:38.242 execute Fluffy_Pillow 41.2/130: 32% rage precise_strikes, shattered_defenses, cleansed_wisps_blessing
5:39.672 execute Fluffy_Pillow 23.6/130: 18% rage cleansed_wisps_blessing
5:41.101 Waiting 0.600 sec 0.0/130: 0% rage cleansed_wisps_blessing
5:41.701 execute Fluffy_Pillow 25.2/130: 19% rage cleansed_wisps_blessing, mark_of_the_heavy_hide
5:43.130 Waiting 0.300 sec 0.0/130: 0% rage mark_of_the_heavy_hide
5:43.430 heroic_leap Fluffy_Pillow 0.0/130: 0% rage mark_of_the_heavy_hide
5:43.646 Waiting 1.400 sec 0.0/130: 0% rage mark_of_the_heavy_hide
5:45.046 execute Fluffy_Pillow 25.2/130: 19% rage mark_of_the_heavy_hide
5:46.474 Waiting 1.600 sec 0.0/130: 0% rage mark_of_the_heavy_hide
5:48.074 charge Fluffy_Pillow 0.0/130: 0% rage raid_movement, mark_of_the_heavy_hide
5:48.074 Waiting 0.100 sec 20.0/130: 15% rage raid_movement, charge_movement, mark_of_the_heavy_hide
5:48.174 execute Fluffy_Pillow 20.0/130: 15% rage raid_movement, charge_movement, mark_of_the_heavy_hide
5:49.604 colossus_smash Fluffy_Pillow 37.6/130: 29% rage mark_of_the_heavy_hide
5:51.033 execute Fluffy_Pillow 37.6/130: 29% rage precise_strikes, shattered_defenses, mark_of_the_heavy_hide
5:52.463 colossus_smash Fluffy_Pillow 45.2/130: 35% rage mark_of_the_heavy_hide
5:53.894 battle_cry Fluffy_Pillow 45.2/130: 35% rage precise_strikes, shattered_defenses, mark_of_the_heavy_hide
5:53.894 potion Fluffy_Pillow 45.2/130: 35% rage corrupted_blood_of_zakajz, precise_strikes, battle_cry, shattered_defenses, mark_of_the_heavy_hide
5:53.894 focused_rage Fluffy_Pillow 45.2/130: 35% rage corrupted_blood_of_zakajz, precise_strikes, battle_cry, shattered_defenses, mark_of_the_heavy_hide, potion_of_the_old_war
5:53.894 execute Fluffy_Pillow 45.2/130: 35% rage corrupted_blood_of_zakajz, focused_rage, precise_strikes, battle_cry, shattered_defenses, mark_of_the_heavy_hide, potion_of_the_old_war
5:55.319 focused_rage Fluffy_Pillow 82.0/130: 63% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry, mark_of_the_heavy_hide, potion_of_the_old_war
5:55.325 execute Fluffy_Pillow 82.0/130: 63% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry, mark_of_the_heavy_hide, potion_of_the_old_war
5:56.744 focused_rage Fluffy_Pillow 82.0/130: 63% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry, mark_of_the_heavy_hide, potion_of_the_old_war
5:56.754 mortal_strike Fluffy_Pillow 82.0/130: 63% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry, mark_of_the_heavy_hide, potion_of_the_old_war
5:58.169 focused_rage Fluffy_Pillow 82.0/130: 63% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, mark_of_the_heavy_hide, potion_of_the_old_war
5:58.184 execute Fluffy_Pillow 82.0/130: 63% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, mark_of_the_heavy_hide, potion_of_the_old_war
5:59.613 colossus_smash Fluffy_Pillow 118.7/130: 91% rage focused_rage, cleansed_ancients_blessing, potion_of_the_old_war
6:01.000 avatar Fluffy_Pillow 118.7/130: 91% rage avatar, focused_rage, precise_strikes, shattered_defenses, cleansed_ancients_blessing, potion_of_the_old_war
6:01.043 execute Fluffy_Pillow 118.7/130: 91% rage avatar, focused_rage, precise_strikes, shattered_defenses, cleansed_ancients_blessing, potion_of_the_old_war
6:02.472 execute Fluffy_Pillow 126.3/130: 97% rage avatar, focused_rage, cleansed_ancients_blessing, potion_of_the_old_war
6:03.901 colossus_smash Fluffy_Pillow 94.3/130: 73% rage avatar, focused_rage, cleansed_ancients_blessing, potion_of_the_old_war
6:05.330 execute Fluffy_Pillow 94.3/130: 73% rage avatar, focused_rage, precise_strikes, shattered_defenses, cleansed_ancients_blessing, cleansed_wisps_blessing, potion_of_the_old_war
6:06.759 execute Fluffy_Pillow 101.9/130: 78% rage avatar, focused_rage, cleansed_ancients_blessing, cleansed_wisps_blessing, potion_of_the_old_war
6:08.188 arcane_torrent Fluffy_Pillow 69.9/130: 54% rage avatar, focused_rage, cleansed_ancients_blessing, cleansed_wisps_blessing, potion_of_the_old_war
6:08.188 colossus_smash Fluffy_Pillow 84.9/130: 65% rage avatar, focused_rage, cleansed_ancients_blessing, cleansed_wisps_blessing, potion_of_the_old_war
6:09.618 execute Fluffy_Pillow 110.1/130: 85% rage avatar, focused_rage, precise_strikes, shattered_defenses, cleansed_wisps_blessing, potion_of_the_old_war
6:11.050 colossus_smash Fluffy_Pillow 92.5/130: 71% rage avatar, focused_rage, cleansed_wisps_blessing, potion_of_the_old_war
6:12.479 execute Fluffy_Pillow 117.7/130: 91% rage avatar, focused_rage, precise_strikes, shattered_defenses, cleansed_wisps_blessing, potion_of_the_old_war
6:13.909 heroic_leap Fluffy_Pillow 100.1/130: 77% rage avatar, focused_rage, cleansed_wisps_blessing, potion_of_the_old_war
6:13.909 execute Fluffy_Pillow 100.1/130: 77% rage avatar, focused_rage, cleansed_wisps_blessing, potion_of_the_old_war
6:15.340 execute Fluffy_Pillow 68.1/130: 52% rage avatar, focused_rage, potion_of_the_old_war
6:16.770 colossus_smash Fluffy_Pillow 61.3/130: 47% rage avatar, focused_rage, mark_of_the_heavy_hide, potion_of_the_old_war
6:18.199 execute Fluffy_Pillow 61.3/130: 47% rage avatar, focused_rage, precise_strikes, shattered_defenses, mark_of_the_heavy_hide, potion_of_the_old_war
6:19.628 execute Fluffy_Pillow 68.9/130: 53% rage avatar, focused_rage, mark_of_the_heavy_hide
6:21.058 execute Fluffy_Pillow 36.9/130: 28% rage raid_movement, focused_rage, mark_of_the_heavy_hide
6:22.489 Waiting 0.200 sec 4.9/130: 4% rage focused_rage, mark_of_the_heavy_hide
6:22.689 execute Fluffy_Pillow 30.1/130: 23% rage focused_rage, mark_of_the_heavy_hide
6:24.118 battle_cry Fluffy_Pillow 0.0/130: 0% rage focused_rage, mark_of_the_heavy_hide
6:24.118 focused_rage Fluffy_Pillow 0.0/130: 0% rage corrupted_blood_of_zakajz, focused_rage, battle_cry, mark_of_the_heavy_hide
6:24.118 execute Fluffy_Pillow 0.0/130: 0% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry, mark_of_the_heavy_hide
6:25.543 focused_rage Fluffy_Pillow 0.0/130: 0% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
6:25.548 colossus_smash Fluffy_Pillow 0.0/130: 0% rage corrupted_blood_of_zakajz, focused_rage(3), battle_cry
6:26.977 mortal_strike Fluffy_Pillow 36.2/130: 28% rage corrupted_blood_of_zakajz, focused_rage(3), precise_strikes, battle_cry, shattered_defenses
6:26.977 focused_rage Fluffy_Pillow 36.2/130: 28% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
6:28.406 execute Fluffy_Pillow 36.2/130: 28% rage corrupted_blood_of_zakajz, focused_rage, battle_cry
6:28.406 focused_rage Fluffy_Pillow 36.2/130: 28% rage corrupted_blood_of_zakajz, focused_rage(2), battle_cry
6:29.834 execute Fluffy_Pillow 61.4/130: 47% rage focused_rage(2)
6:31.263 colossus_smash Fluffy_Pillow 29.4/130: 23% rage focused_rage(2)
6:32.691 execute Fluffy_Pillow 29.4/130: 23% rage focused_rage(2), precise_strikes, shattered_defenses
6:34.121 execute Fluffy_Pillow 37.0/130: 28% rage focused_rage(2)
6:35.551 bladestorm Fluffy_Pillow 5.0/130: 4% rage focused_rage(2)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 25137 23431 12087 (10156)
Agility 6579 6254 0
Stamina 31334 31334 19320
Intellect 5328 5003 0
Spirit 2 2 0
Health 1880040 1880040 0
Rage 130 130 0
Crit 9.93% 9.93% 1377
Haste 5.23% 5.23% 1700
Damage / Heal Versatility 10.35% 10.35% 4138
Attack Power 25137 23431 0
Mastery 78.62% 76.48% 10585
Armor 4018 4018 4018
Run Speed 7 0 0
Leech 2.39% 2.39% 549

Gear

Source Slot Average Item Level: 850.00
Local Head Subterranean Horror Faceguard
ilevel: 845, stats: { 548 Armor, +1238 StrInt, +1857 Sta, +777 Mastery, +503 Haste, +549 Leech }
Local Neck Krakentooth Necklace
ilevel: 860, stats: { +1201 Sta, +1307 Mastery, +599 Vers }, enchant: mark_of_the_heavy_hide
Local Shoulders Wardbreaker Pauldrons
ilevel: 845, stats: { 506 Armor, +929 StrInt, +1393 Sta, +625 Vers, +336 Mastery }, gems: { +200 Str }
Local Chest Coralplate Chestguard
ilevel: 845, stats: { 675 Armor, +1238 StrInt, +1857 Sta, +860 Mastery, +420 Vers }
Local Waist Greatbelt of Disruption
ilevel: 850, stats: { 384 Armor, +973 StrInt, +1459 Sta, +594 Vers, +385 Mastery }
Local Legs Arcane Defender's Pants
ilevel: 840, stats: { 584 Armor, +1182 StrInt, +1773 Sta, +899 Mastery, +359 Haste }
Local Feet Leadfoot Earthshakers
ilevel: 845, stats: { 464 Armor, +929 StrInt, +1393 Sta, +666 Mastery, +295 Vers }
Local Wrists Dragonbone Wristclamps
ilevel: 855, stats: { 302 Armor, +1147 Sta, +765 StrInt, +502 Mastery, +245 Haste }
Local Hands Stormwake Handguards
ilevel: 850, stats: { 427 Armor, +973 StrInt, +1459 Sta, +658 Mastery, +322 Crit }
Local Finger1 Braided Silver Ring
ilevel: 850, stats: { +1094 Sta, +997 Mastery, +839 Vers }, gems: { +150 Mastery }, enchant: { +200 Mastery }
Local Finger2 Loop of Eightfold Eyes
ilevel: 845, stats: { +1045 Sta, +1236 Mastery, +566 Vers }, enchant: { +200 Vers }
Local Trinket1 Nature's Call
ilevel: 850, stats: { +310 Mastery, +310 Haste, +310 Crit }
Local Trinket2 Chrono Shard
ilevel: 850, stats: { +1233 StrAgiInt }, gems: { +150 Mastery }
Local Back Cape of Rigid Order
ilevel: 845, stats: { 128 Armor, +696 StrAgiInt, +1045 Sta, +437 Mastery, +283 Haste }
Local Main Hand Strom'kar, the Warbreaker
ilevel: 881, weapon: { 8957 - 13437, 3.6 }, stats: { +1731 Str, +2597 Sta, +745 Crit, +715 Mastery }, relics: { +48 ilevels, +40 ilevels, +43 ilevels }

Talents

Level
15 Dauntless (Arms Warrior) Overpower (Arms Warrior) Sweeping Strikes (Arms Warrior)
30 Shockwave (Arms Warrior) Storm Bolt (Arms Warrior) Double Time
45 Fervor of Battle (Arms Warrior) Rend (Arms Warrior) Avatar
60 Second Wind Bounding Stride Defensive Stance (Arms Warrior)
75 In For The Kill (Arms Warrior) Mortal Combo (Arms Warrior) Focused Rage (Arms Warrior)
90 Deadly Calm (Arms Warrior) Trauma (Arms Warrior) Titanic Might (Arms Warrior)
100 Anger Management Opportunity Strikes (Arms Warrior) Ravager (Arms Warrior)

Profile

warrior="Alacastria"
origin="https://us.api.battle.net/wow/character/thrall/Alacastria/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/45/155500077-avatar.jpg"
level=110
race=blood_elf
role=attack
position=back
professions=blacksmithing=758/mining=784
talents=1332311
artifact=36:0:0:0:0:1136:1:1137:1:1138:1:1139:1:1141:1:1142:1:1143:3:1145:3:1146:3:1148:3:1149:3:1150:3:1356:1
spec=arms

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=countless_armies
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=charge
actions+=/auto_attack
actions+=/potion,name=old_war,if=(target.health.pct<20&buff.battle_cry.up)|target.time_to_die<=26
actions+=/blood_fury,if=buff.battle_cry.up|target.time_to_die<=16
actions+=/berserking,if=buff.battle_cry.up|target.time_to_die<=11
actions+=/arcane_torrent,if=buff.battle_cry_deadly_calm.down&rage.deficit>40
actions+=/battle_cry,if=(buff.bloodlust.up|time>=1)&!gcd.remains&(buff.shattered_defenses.up|(cooldown.colossus_smash.remains&cooldown.warbreaker.remains))|target.time_to_die<=10
actions+=/avatar,if=(buff.bloodlust.up|time>=1)
actions+=/heroic_leap,if=debuff.colossus_smash.up
actions+=/rend,if=remains<gcd
# The tl;dr of this line is to spam focused rage inside battle cry, the added nonsense is to help modeling the difficulty of timing focused rage immediately after mortal strike.
# In game, if focused rage is used the same instant as mortal strike, rage will be deducted for focused rage, the buff is immediately consumed, but it does not buff the damage of mortal strike.
actions+=/focused_rage,if=buff.battle_cry_deadly_calm.remains>cooldown.focused_rage.remains&(buff.focused_rage.stack<3|!cooldown.mortal_strike.up)&((!buff.focused_rage.react&prev_gcd.mortal_strike)|!prev_gcd.mortal_strike)
actions+=/colossus_smash,if=debuff.colossus_smash.down
actions+=/warbreaker,if=debuff.colossus_smash.down
actions+=/ravager
actions+=/overpower,if=buff.overpower.react
actions+=/run_action_list,name=cleave,if=spell_targets.whirlwind>=2&talent.sweeping_strikes.enabled
actions+=/run_action_list,name=aoe,if=spell_targets.whirlwind>=2&!talent.sweeping_strikes.enabled
actions+=/run_action_list,name=execute,if=target.health.pct<=20
actions+=/run_action_list,name=single,if=target.health.pct>20

actions.aoe=mortal_strike
actions.aoe+=/execute,if=buff.stone_heart.react
actions.aoe+=/colossus_smash,if=buff.shattered_defenses.down&buff.precise_strikes.down
actions.aoe+=/warbreaker,if=buff.shattered_defenses.down
actions.aoe+=/whirlwind,if=talent.fervor_of_battle.enabled&(debuff.colossus_smash.up|rage.deficit<50)&(!talent.focused_rage.enabled|buff.battle_cry_deadly_calm.up|buff.cleave.up)
actions.aoe+=/rend,if=remains<=duration*0.3
actions.aoe+=/bladestorm
actions.aoe+=/cleave
actions.aoe+=/whirlwind,if=rage>=60
actions.aoe+=/shockwave
actions.aoe+=/storm_bolt

actions.cleave=mortal_strike
actions.cleave+=/execute,if=buff.stone_heart.react
actions.cleave+=/colossus_smash,if=buff.shattered_defenses.down&buff.precise_strikes.down
actions.cleave+=/warbreaker,if=buff.shattered_defenses.down
actions.cleave+=/focused_rage,if=buff.shattered_defenses.down
actions.cleave+=/whirlwind,if=talent.fervor_of_battle.enabled&(debuff.colossus_smash.up|rage.deficit<50)&(!talent.focused_rage.enabled|buff.battle_cry_deadly_calm.up|buff.cleave.up)
actions.cleave+=/rend,if=remains<=duration*0.3
actions.cleave+=/bladestorm
actions.cleave+=/cleave
actions.cleave+=/whirlwind,if=rage>=100|buff.focused_rage.stack=3
actions.cleave+=/shockwave
actions.cleave+=/storm_bolt

actions.execute=mortal_strike,if=buff.battle_cry.up&buff.focused_rage.stack=3
actions.execute+=/execute,if=buff.battle_cry_deadly_calm.up
actions.execute+=/colossus_smash,if=buff.shattered_defenses.down
actions.execute+=/warbreaker,if=buff.shattered_defenses.down&rage<=30
actions.execute+=/execute,if=buff.shattered_defenses.up&rage>22|buff.shattered_defenses.down
# actions.single+=/heroic_charge,if=rage.deficit>=40&(!cooldown.heroic_leap.remains|swing.mh.remains>1.2)
#Remove the # above to run out of melee and charge back in for rage.
actions.execute+=/bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets

actions.single=mortal_strike,if=buff.battle_cry.up&buff.focused_rage.stack>=1&buff.battle_cry.remains<gcd
actions.single+=/colossus_smash,if=buff.shattered_defenses.down
actions.single+=/warbreaker,if=buff.shattered_defenses.down&cooldown.mortal_strike.remains<gcd
actions.single+=/focused_rage,if=(((!buff.focused_rage.react&prev_gcd.mortal_strike)|!prev_gcd.mortal_strike)&buff.focused_rage.stack<3&(buff.shattered_defenses.up|cooldown.colossus_smash.remains))&rage>60
actions.single+=/mortal_strike
actions.single+=/execute,if=buff.stone_heart.react
actions.single+=/slam
actions.single+=/execute,if=equipped.archavons_heavy_hand
actions.single+=/focused_rage,if=equipped.archavons_heavy_hand
# actions.single+=/heroic_charge,if=rage.deficit>=40&(!cooldown.heroic_leap.remains|swing.mh.remains>1.2)
#Remove the # above to run out of melee and charge back in for rage.
actions.single+=/bladestorm,interrupt=1,if=raid_event.adds.in>90|!raid_event.adds.exists|spell_targets.bladestorm_mh>desired_targets

head=subterranean_horror_faceguard,id=134511,bonus_id=1727/41/1497/3336
neck=krakentooth_necklace,id=141473,bonus_id=1472,enchant=mark_of_the_heavy_hide
shoulders=wardbreaker_pauldrons,id=136730,bonus_id=1727/1808/1507/3336,gems=200str
back=cape_of_rigid_order,id=134402,bonus_id=3411/1497/1813
chest=coralplate_chestguard,id=134223,bonus_id=3397/1507/3337
wrists=dragonbone_wristclamps,id=138218,bonus_id=1807/1477/3336
hands=stormwake_handguards,id=134508,bonus_id=3412/1502/1813
waist=greatbelt_of_disruption,id=137310,bonus_id=3410/1502/3336
legs=arcane_defenders_pants,id=134271,bonus_id=1727/1502/1813
feet=leadfoot_earthshakers,id=134507,bonus_id=1727/1497/3336
finger1=braided_silver_ring,id=134539,bonus_id=3412/1808/1502/1813,gems=150mastery,enchant=200mastery
finger2=loop_of_eightfold_eyes,id=134527,bonus_id=1726/1497/3337,enchant=200vers
trinket1=natures_call,id=139334,bonus_id=1807/1472
trinket2=chrono_shard,id=137419,bonus_id=1727/1808/1502/3336,gems=150mastery
main_hand=stromkar_the_warbreaker,id=128910,bonus_id=750,gem_id=137371/137363/139251/0,relic_id=3414:1517:3336/1727:1492:1813/1807:1472/0

# Gear Summary
# gear_ilvl=850.40
# gear_strength=12087
# gear_stamina=19320
# gear_crit_rating=1377
# gear_haste_rating=1700
# gear_mastery_rating=10585
# gear_versatility_rating=4138
# gear_leech_rating=549
# gear_armor=4018

Simulation & Raid Information

Iterations: 10003
Threads: 4
Confidence: 95.00%
Fight Length: 308 - 502 ( 401.0 )

Performance:

Total Events Processed: 855228923
Max Event Queue: 512
Sim Seconds: 4011172
CPU Seconds: 959.6562
Physical Seconds: 250.6161
Speed Up: 4180

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Illistan Illistan annihilation 201427 5696048 14205 3.96 139413 320408 13.2 26.4 42.0% 0.0% 0.0% 0.0% 15.02sec 5696048 401.00sec
Illistan Illistan augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Illistan Illistan auto_attack_mh 0 2893986 7217 17.81 19783 39570 119.0 119.0 41.9% 19.0% 0.0% 0.0% 3.38sec 4254433 401.00sec
Illistan Illistan auto_attack_oh 1 1448324 3612 17.81 9891 19785 119.0 119.0 41.9% 18.9% 0.0% 0.0% 3.38sec 2129174 401.00sec
Illistan Illistan blade_dance 188499 20374410 50809 68.09 31558 63167 19.5 455.1 41.8% 0.0% 0.0% 0.0% 14.59sec 29952313 401.00sec
Illistan Illistan blur 198589 0 0 0.00 0 0 0.2 0.0 0.0% 0.0% 0.0% 0.0% 125.22sec 0 401.00sec
Illistan Illistan chaos_blade_mh 211796 3153558 7864 2.58 128925 257785 17.2 17.2 41.9% 0.0% 0.0% 0.0% 21.84sec 3153558 401.00sec
Illistan Illistan chaos_blade_oh 211797 1576537 3932 2.58 64447 128935 17.2 17.2 41.9% 0.0% 0.0% 0.0% 21.84sec 1576537 401.00sec
Illistan Illistan chaos_blades 211048 0 0 0.00 0 0 3.3 0.0 0.0% 0.0% 0.0% 0.0% 150.57sec 0 401.00sec
Illistan Illistan chaos_strike 162794 23127060 57674 23.89 93774 215639 79.9 159.7 41.9% 0.0% 0.0% 0.0% 4.60sec 23127060 401.00sec
Illistan Illistan consume_soul_lesser 203794 0 0 0.00 0 0 16.4 0.0 0.0% 0.0% 0.0% 0.0% 24.72sec 0 401.00sec
Illistan Illistan death_sweep 210152 2779003 6930 6.68 43942 87786 2.0 44.6 41.8% 0.0% 0.0% 0.0% 5.70sec 4085398 401.00sec
Illistan Illistan demonic_appetite_fury 210041 0 0 0.00 0 0 16.4 0.0 0.0% 0.0% 0.0% 0.0% 24.72sec 0 401.00sec
Illistan Illistan demons_bite 162243 8303026 20706 15.63 56025 112062 104.5 104.5 41.9% 0.0% 0.0% 0.0% 3.81sec 12206234 401.00sec
Illistan Illistan eye_beam ticks -198013 14124672 35312 10.16 0 45984 7.3 67.7 100.0% 0.0% 0.0% 0.0% 55.44sec 14124672 401.00sec
Illistan Illistan anguish 202446 6088591 15184 4.76 134682 269701 0.0 31.8 41.9% 0.0% 0.0% 0.0% 0.00sec 6088591 401.00sec
Illistan Illistan fel_rush 195072 33408565 83314 25.23 139613 279233 40.6 168.6 41.9% 0.0% 0.0% 0.0% 9.93sec 33408565 401.00sec
Illistan Illistan flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Illistan Illistan food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Illistan Illistan fury_of_the_illidari ticks -201467 17269757 43174 7.40 27195 54383 7.1 49.4 41.9% 0.0% 0.0% 0.0% 60.54sec 17269757 401.00sec
Illistan Illistan rage_of_the_illidari 217070 10355094 25823 4.74 326583 0 7.0 31.7 0.0% 0.0% 0.0% 0.0% 60.54sec 10355094 401.00sec
Illistan Illistan metamorphosis 191427 0 0 0.00 0 0 0.4 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Illistan Illistan metamorphosis_impact 200166 131597 328 0.21 65861 131722 1.4 1.4 41.7% 0.0% 0.0% 0.0% 0.00sec 131597 401.00sec
Illistan Illistan nemesis 206491 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.48sec 0 401.00sec
Illistan Illistan pick_up_fragment 0 0 0 0.00 0 0 21.0 0.0 0.0% 0.0% 0.0% 0.0% 19.10sec 0 401.00sec
Illistan Illistan potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Illistan Illistan potion_of_the_old_war 188028 4627881 11541 3.59 135776 271684 24.0 24.0 41.8% 0.0% 0.0% 0.0% 16.66sec 6803424 401.00sec
Illistan Illistan throw_glaive 185123 16321867 40703 16.12 106747 213530 47.6 107.7 41.9% 0.0% 0.0% 0.0% 8.47sec 23994690 401.00sec
Illistan Illistan bloodlet ticks -207690 20314124 50785 53.58 56869 0 0.0 357.2 0.0% 0.0% 0.0% 0.0% 0.00sec 20314124 401.00sec
Illistan Illistan vengeful_retreat 198793 27371 68 0.16 18283 36571 0.2 1.1 42.1% 0.0% 0.0% 0.0% 80.27sec 40237 401.00sec
Mortwraith Mortwraith annihilation 201427 6014236 14998 4.78 132047 288033 16.0 31.9 36.1% 0.0% 0.0% 0.0% 18.57sec 6014236 401.00sec
Mortwraith Mortwraith augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Mortwraith Mortwraith auto_attack_mh 0 3124535 7792 19.84 20175 40344 132.6 132.6 35.9% 19.1% 0.0% 0.0% 3.02sec 4593362 401.00sec
Mortwraith Mortwraith auto_attack_oh 1 1563844 3900 19.84 10087 20172 132.6 132.6 35.9% 19.0% 0.0% 0.0% 3.02sec 2299000 401.00sec
Mortwraith Mortwraith blade_dance 188499 18044391 44999 62.82 31619 63224 18.2 419.8 35.9% 0.0% 0.0% 0.0% 15.69sec 26526964 401.00sec
Mortwraith Mortwraith blur 198589 0 0 0.00 0 0 0.3 0.0 0.0% 0.0% 0.0% 0.0% 182.72sec 0 401.00sec
Mortwraith Mortwraith chaos_strike 162794 20578759 51319 21.52 100520 219063 72.0 143.8 35.9% 0.0% 0.0% 0.0% 5.10sec 20578759 401.00sec
Mortwraith Mortwraith death_sweep 210152 7966806 19868 18.19 48151 96391 5.3 121.6 36.0% 0.0% 0.0% 0.0% 58.07sec 11711959 401.00sec
Mortwraith Mortwraith demons_bite 162243 6515944 16249 14.90 48119 96238 99.6 99.6 36.0% 0.0% 0.0% 0.0% 3.99sec 9579055 401.00sec
Mortwraith Mortwraith eye_beam ticks -198013 28347802 70870 17.07 0 49509 11.9 113.8 100.0% 0.0% 0.0% 0.0% 32.38sec 28347802 401.00sec
Mortwraith Mortwraith anguish 202446 11731438 29256 8.73 147879 295555 0.0 58.3 36.0% 0.0% 0.0% 0.0% 0.00sec 11731438 401.00sec
Mortwraith Mortwraith fel_barrage 211053 19294507 48116 23.92 88806 177604 10.2 159.9 35.9% 0.0% 0.0% 0.0% 41.09sec 19294507 401.00sec
Mortwraith Mortwraith fel_rush 195072 22094120 55098 18.48 131573 263081 34.6 123.5 36.0% 0.0% 0.0% 0.0% 11.81sec 22094120 401.00sec
Mortwraith Mortwraith flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Mortwraith Mortwraith food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Mortwraith Mortwraith fury_of_the_illidari ticks -201467 18045855 45115 7.40 29637 59258 7.1 49.3 35.9% 0.0% 0.0% 0.0% 60.53sec 18045855 401.00sec
Mortwraith Mortwraith rage_of_the_illidari 217070 10819133 26981 4.76 340053 0 7.0 31.8 0.0% 0.0% 0.0% 0.0% 60.53sec 10819133 401.00sec
Mortwraith Mortwraith metamorphosis 191427 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 242.37sec 0 401.00sec
Mortwraith Mortwraith metamorphosis_impact 200166 703456 1754 1.02 75686 151296 2.0 6.8 36.2% 0.0% 0.0% 0.0% 242.37sec 703456 401.00sec
Mortwraith Mortwraith potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Mortwraith Mortwraith potion_of_the_old_war 188028 4834218 12055 3.68 144478 288902 24.6 24.6 35.9% 0.0% 0.0% 0.0% 11.81sec 7106758 401.00sec
Mortwraith Mortwraith throw_glaive 185123 16429725 40972 16.44 109963 219925 48.6 109.9 36.0% 0.0% 0.0% 0.0% 8.28sec 24153252 401.00sec
Mortwraith Mortwraith bloodlet ticks -207690 20190079 50475 53.21 56915 0 0.0 354.7 0.0% 0.0% 0.0% 0.0% 0.00sec 20190079 401.00sec
Mortwraith Mortwraith vengeful_retreat 198793 2077390 5181 13.51 16923 33845 25.6 90.3 35.9% 0.0% 0.0% 0.0% 15.83sec 3053960 401.00sec
Táunks Táunks annihilation 201427 5158701 12865 4.51 116563 261018 15.1 30.1 37.8% 0.0% 0.0% 0.0% 19.88sec 5158701 401.00sec
Táunks Táunks augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Táunks Táunks auto_attack_mh 0 3194928 7967 21.58 18657 37315 144.2 144.2 37.7% 19.0% 0.0% 0.0% 2.77sec 4696847 401.00sec
Táunks Táunks auto_attack_oh 1 1598310 3986 21.58 9328 18655 144.2 144.2 37.7% 18.9% 0.0% 0.0% 2.77sec 2349666 401.00sec
Táunks Táunks blade_dance 188499 18270365 45562 66.64 29804 59596 19.5 445.3 37.7% 0.0% 0.0% 0.0% 14.76sec 26859167 401.00sec
Táunks Táunks chaos_strike 162794 16475366 41086 18.57 90500 202687 62.1 124.1 37.6% 0.0% 0.0% 0.0% 5.87sec 16475366 401.00sec
Táunks Táunks death_sweep 210152 6679702 16658 16.53 43932 87875 4.9 110.4 37.7% 0.0% 0.0% 0.0% 64.01sec 9819795 401.00sec
Táunks Táunks demon_blades 203796 6163312 15370 26.11 25657 51323 174.5 174.5 37.6% 0.0% 0.0% 0.0% 4.90sec 6163312 401.00sec
Táunks Táunks eye_beam ticks -198013 14394321 35986 10.49 0 46088 7.3 70.0 100.0% 0.0% 0.0% 0.0% 55.14sec 14394321 401.00sec
Táunks Táunks anguish 202446 5634159 14050 4.60 133084 266215 0.0 30.8 37.6% 0.0% 0.0% 0.0% 0.00sec 5634159 401.00sec
Táunks Táunks fel_barrage 211053 15329134 38228 20.67 80624 161217 9.1 138.2 37.6% 0.0% 0.0% 0.0% 46.10sec 15329134 401.00sec
Táunks Táunks fel_rush 195072 25097638 62588 22.23 122701 245409 38.6 148.6 37.6% 0.0% 0.0% 0.0% 10.51sec 25097638 401.00sec
Táunks Táunks flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Táunks Táunks food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Táunks Táunks fury_of_the_illidari ticks -201467 16667503 41669 7.42 27002 54011 7.1 49.5 37.7% 0.0% 0.0% 0.0% 60.35sec 16667503 401.00sec
Táunks Táunks inner_demons 202388 4716206 11761 2.22 230805 461552 6.5 14.8 37.7% 0.0% 0.0% 0.0% 56.66sec 4716206 401.00sec
Táunks Táunks metamorphosis 191427 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 244.58sec 0 401.00sec
Táunks Táunks metamorphosis_impact 200166 476824 1189 0.75 69171 138439 2.0 5.0 38.1% 0.0% 0.0% 0.0% 244.58sec 476824 401.00sec
Táunks Táunks potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Táunks Táunks potion_of_the_old_war 188028 4336240 10814 3.54 133141 266219 23.7 23.7 37.7% 0.0% 0.0% 0.0% 12.55sec 6374683 401.00sec
Táunks Táunks throw_glaive 185123 16017171 39943 17.18 101363 202714 50.6 114.8 37.6% 0.0% 0.0% 0.0% 7.96sec 23546758 401.00sec
Táunks Táunks bloodlet ticks -207690 19649908 49125 54.09 54494 0 0.0 360.6 0.0% 0.0% 0.0% 0.0% 0.00sec 19649908 401.00sec
Táunks Táunks vengeful_retreat 198793 1230161 3068 8.37 15959 31919 15.9 56.0 37.7% 0.0% 0.0% 0.0% 25.79sec 1808453 401.00sec
Buuey Buuey augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Buuey Buuey blessing_of_elune 202737 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Buuey Buuey celestial_alignment 194223 0 0 0.00 0 0 2.5 0.0 0.0% 0.0% 0.0% 0.0% 191.64sec 0 401.00sec
Buuey Buuey deadly_grace 188091 3244389 8091 3.75 105406 215121 25.3 25.1 21.9% 0.0% 0.0% 0.0% 9.14sec 3244389 401.00sec
Buuey Buuey flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Buuey Buuey food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Buuey Buuey full_moon 202771 7218297 18001 2.52 348217 711358 7.7 16.9 21.9% 0.0% 0.0% 0.0% 54.56sec 5668205 401.00sec
Buuey Buuey half_moon 202768 3330350 8305 1.20 337495 688489 8.1 8.0 22.1% 0.0% 0.0% 0.0% 52.05sec 3330350 401.00sec
Buuey Buuey lunar_strike 194153 22979277 57305 40.44 61457 125291 56.1 270.3 36.9% 0.0% 0.0% 0.0% 6.75sec 22979277 401.00sec
Buuey Buuey moonfire 8921 1157788 2887 2.82 50056 102140 18.8 18.8 21.9% 0.0% 0.0% 0.0% 22.03sec 8464151 401.00sec
Buuey Buuey moonfire ticks -8921 7306363 18266 36.29 24586 50156 18.8 241.9 21.9% 0.0% 0.0% 0.0% 22.03sec 8464151 401.00sec
Buuey Buuey moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Buuey Buuey new_moon 202767 1732393 4320 1.25 168748 344246 7.4 8.4 21.9% 0.0% 0.0% 0.0% 54.26sec 1732393 401.00sec
Buuey Buuey potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Buuey Buuey solar_wrath 190984 9161444 22847 10.38 107497 219411 70.1 69.4 22.0% 0.0% 0.0% 0.0% 5.65sec 9161444 401.00sec
Buuey Buuey starfall ticks -191034 19506339 48766 0.00 24402 49786 15.3 0.0 21.9% 0.0% 0.0% 0.0% 21.76sec 19506339 401.00sec
Buuey Buuey echoing_stars ticks -226104 3446814 8617 0.00 4647 9479 0.0 0.0 21.9% 0.0% 0.0% 0.0% 0.00sec 3446814 401.00sec
Buuey Buuey starsurge 78674 5075745 12658 2.05 261882 534399 13.7 13.7 39.9% 0.0% 0.0% 0.0% 29.23sec 5075745 401.00sec
Buuey Buuey goldrinns_fang 203001 877520 2188 0.67 159109 324575 4.5 4.5 22.0% 0.0% 0.0% 0.0% 69.98sec 877520 401.00sec
Buuey Buuey stellar_flare 202347 1329214 3315 2.12 76378 155726 14.2 14.2 22.0% 0.0% 0.0% 0.0% 29.19sec 7625674 401.00sec
Buuey Buuey stellar_flare ticks -202347 6296460 15741 30.37 25320 51671 14.2 202.5 21.9% 0.0% 0.0% 0.0% 29.19sec 7625674 401.00sec
Buuey Buuey sunfire 93402 3930490 9802 9.99 47955 97861 15.2 66.7 21.9% 0.0% 0.0% 0.0% 23.64sec 19380966 401.00sec
Buuey Buuey sunfire ticks -93402 15450476 38626 77.87 24246 49432 15.2 519.1 21.9% 0.0% 0.0% 0.0% 23.64sec 19380966 401.00sec
Buuey Buuey tormenting_cyclone 221857 4807006 11988 48.53 12070 24626 13.7 324.3 21.9% 0.0% 0.0% 0.0% 28.36sec 4807006 401.00sec
Oinkie Oinkie ashamanes_rip ticks -210705 4129595 10324 10.11 46016 93892 7.7 67.4 31.9% 0.0% 0.0% 0.0% 48.58sec 4129595 401.00sec
Oinkie Oinkie augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Oinkie Oinkie cat_form 768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Oinkie Oinkie cat_melee 0 10098918 25185 64.69 17549 35797 432.3 432.3 31.8% 0.0% 0.0% 0.0% 0.93sec 14291360 401.00sec
Oinkie Oinkie dash 1850 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 188.76sec 0 401.00sec
Oinkie Oinkie ferocious_bite 22568 2905855 7247 2.19 141290 319016 14.7 14.7 32.1% 0.0% 0.0% 0.0% 28.44sec 4106831 401.00sec
Oinkie Oinkie flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Oinkie Oinkie food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Oinkie Oinkie incarnation 102543 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 181.08sec 0 401.00sec
Oinkie Oinkie lunar_inspiration 155625 754150 1881 2.62 32440 66196 17.5 17.5 31.6% 0.0% 0.0% 0.0% 23.61sec 5403734 401.00sec
Oinkie Oinkie lunar_inspiration ticks -155625 4649585 11624 22.14 23656 48290 17.5 147.6 31.8% 0.0% 0.0% 0.0% 23.61sec 5403734 401.00sec
Oinkie Oinkie potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Oinkie Oinkie potion_of_the_old_war 188028 4395560 10962 3.64 136119 277578 24.3 24.3 31.7% 0.0% 0.0% 0.0% 13.99sec 6461889 401.00sec
Oinkie Oinkie rake 1822 1700416 4240 2.86 66921 136272 19.1 19.1 31.9% 0.0% 0.0% 0.0% 22.40sec 9969616 401.00sec
Oinkie Oinkie rake ticks -1822 8269200 20673 16.68 55832 113870 19.1 111.2 31.9% 0.0% 0.0% 0.0% 22.40sec 9969616 401.00sec
Oinkie Oinkie rip ticks -1079 18544310 46361 46.77 44640 91062 23.4 311.8 31.9% 0.0% 0.0% 0.0% 14.28sec 18544310 401.00sec
Oinkie Oinkie shred 5221 9371948 23372 7.71 74771 215984 51.5 51.5 75.9% 0.0% 0.0% 0.0% 7.83sec 13224598 401.00sec
Oinkie Oinkie swipe_cat 106785 28791365 71799 64.30 50312 102642 71.6 429.8 31.9% 0.0% 0.0% 0.0% 4.07sec 41892595 401.00sec
Oinkie Oinkie thrash_cat 106830 3666148 9143 22.00 18714 38183 24.5 147.1 31.9% 0.0% 0.0% 0.0% 12.11sec 13150486 401.00sec
Oinkie Oinkie thrash_cat ticks -106830 9484338 23711 84.99 12571 25642 24.5 566.6 31.9% 0.0% 0.0% 0.0% 12.11sec 13150486 401.00sec
Oinkie Oinkie tigers_fury 5217 0 0 0.00 0 0 13.6 0.0 0.0% 0.0% 0.0% 0.0% 30.52sec 0 401.00sec
Oinkie Oinkie wild_charge 102401 0 0 0.00 0 0 16.2 0.0 0.0% 0.0% 0.0% 0.0% 24.23sec 0 401.00sec
Rothlandra Rothlandra aimed_shot 19434 35426145 88345 15.66 220763 517320 104.8 104.7 39.7% 0.0% 0.0% 0.0% 3.81sec 52079789 401.00sec
Rothlandra Rothlandra legacy_of_the_windrunners 19434 6153670 15346 14.00 42945 100789 0.0 93.6 39.5% 0.0% 0.0% 0.0% 0.00sec 9046478 401.00sec
Rothlandra Rothlandra arcane_torrent 80483 0 0 0.00 0 0 4.8 0.0 0.0% 0.0% 0.0% 0.0% 91.13sec 0 401.00sec
Rothlandra Rothlandra augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Rothlandra Rothlandra auto_shot 0 5118943 12766 22.41 24454 52555 149.8 149.8 34.6% 0.0% 0.0% 0.0% 2.68sec 7525331 401.00sec
Rothlandra Rothlandra barrage ticks -120360 30887559 77219 44.24 21821 46188 19.3 295.0 33.1% 0.0% 0.0% 0.0% 21.28sec 45407638 401.00sec
Rothlandra Rothlandra deadly_grace 188091 3306801 8246 4.49 79173 184705 30.1 30.0 29.3% 0.0% 0.0% 0.0% 3.81sec 3306801 401.00sec
Rothlandra Rothlandra flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Rothlandra Rothlandra marked_shot 185901 43697695 108973 16.21 299643 622729 33.9 108.3 32.1% 0.0% 0.0% 0.0% 11.85sec 64239750 401.00sec
Rothlandra Rothlandra pepper_breath ticks -225622 1543884 3860 13.81 16975 0 18.5 92.1 0.0% 0.0% 0.0% 0.0% 21.40sec 1543884 401.00sec
Rothlandra Rothlandra potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Rothlandra Rothlandra sidewinders 214579 18778592 46830 21.36 98320 203899 41.7 142.7 31.5% 0.0% 0.0% 0.0% 9.65sec 18778592 401.00sec
Rothlandra Rothlandra tormenting_cyclone 221857 5318354 13263 48.80 12160 25275 13.8 326.2 31.6% 0.0% 0.0% 0.0% 28.09sec 5318354 401.00sec
Rothlandra Rothlandra trueshot 193526 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 173.67sec 0 401.00sec
Rothlandra Rothlandra windburst 204147 7655523 19091 2.46 342026 704056 15.5 16.4 34.1% 0.0% 0.0% 0.0% 25.06sec 11254344 401.00sec
Sarkul Sarkul aimed_shot 19434 45683134 113924 17.31 271036 627295 115.8 115.7 34.8% 0.0% 0.0% 0.0% 3.46sec 67158534 401.00sec
Sarkul Sarkul legacy_of_the_windrunners 19434 7943179 19809 15.48 52587 121947 0.0 103.4 34.9% 0.0% 0.0% 0.0% 0.00sec 11677225 401.00sec
Sarkul Sarkul augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Sarkul Sarkul auto_shot 0 5350030 13342 23.89 25090 54176 159.6 159.6 29.0% 0.0% 0.0% 0.0% 2.52sec 7865050 401.00sec
Sarkul Sarkul volley 194386 29662245 73971 81.36 42468 89439 160.6 543.8 25.7% 0.0% 0.0% 0.0% 2.52sec 43606310 401.00sec
Sarkul Sarkul blood_fury 20572 0 0 0.00 0 0 3.8 0.0 0.0% 0.0% 0.0% 0.0% 120.50sec 0 401.00sec
Sarkul Sarkul deadly_grace 188091 3812801 9508 4.64 80707 206105 31.0 31.0 33.7% 0.0% 0.0% 0.0% 11.85sec 3812801 401.00sec
Sarkul Sarkul flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Sarkul Sarkul mark_of_the_hidden_satyr 191259 1517113 3783 3.36 50459 109017 22.5 22.5 29.1% 0.0% 0.0% 0.0% 17.81sec 1517113 401.00sec
Sarkul Sarkul marked_shot 185901 46612268 116241 15.15 327344 693683 36.1 101.2 36.3% 0.0% 0.0% 0.0% 11.18sec 68524449 401.00sec
Sarkul Sarkul call_of_the_hunter 191070 3991128 9953 7.33 62085 133754 14.4 49.0 27.0% 0.0% 0.0% 0.0% 52.80sec 5867337 401.00sec
Sarkul Sarkul pepper_breath ticks -225622 1500204 3751 13.37 16976 0 17.9 89.1 0.0% 0.0% 0.0% 0.0% 22.05sec 1500204 401.00sec
Sarkul Sarkul potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Sarkul Sarkul rancid_maw 215405 4617424 11515 2.68 193161 417647 18.0 17.9 29.0% 0.0% 0.0% 0.0% 22.02sec 4617424 401.00sec
Sarkul Sarkul sidewinders 214579 18042746 44995 20.87 100388 212005 41.1 139.5 25.9% 0.0% 0.0% 0.0% 9.82sec 18042746 401.00sec
Sarkul Sarkul trueshot 193526 0 0 0.00 0 0 2.6 0.0 0.0% 0.0% 0.0% 0.0% 206.64sec 0 401.00sec
Sarkul Sarkul windburst 204147 8685559 21660 2.52 391194 819451 15.9 16.8 29.0% 0.0% 0.0% 0.0% 24.53sec 12768594 401.00sec
Zipi Zipi augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Zipi Zipi blade_of_justice 184575 14117991 35207 7.68 181886 560067 51.3 51.3 24.6% 0.0% 0.0% 0.0% 7.83sec 20754784 401.00sec
Zipi Zipi blessing_of_might_proc 205729 12621575 31475 41.46 45550 0 372.1 277.1 0.0% 0.0% 0.0% 0.0% 1.99sec 12621575 401.00sec
Zipi Zipi crusade 231895 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 128.48sec 0 401.00sec
Zipi Zipi divine_storm 53385 42776732 106676 40.06 127296 259427 44.6 267.7 24.6% 0.0% 0.0% 0.0% 6.52sec 42776732 401.00sec
Zipi Zipi execution_sentence ticks -213757 9491514 23729 2.50 452644 920727 17.0 16.7 24.8% 0.0% 0.0% 0.0% 24.48sec 9491514 401.00sec
Zipi Zipi flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Zipi Zipi food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Zipi Zipi greater_blessing_of_might 203528 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Zipi Zipi judgment 20271 9431360 23520 6.75 166510 339427 45.1 45.1 24.6% 0.0% 0.0% 0.0% 8.90sec 9431360 401.00sec
Zipi Zipi judgment_aoe 228288 4559966 11372 3.44 157766 322169 45.1 23.0 24.6% 0.0% 0.0% 0.0% 8.90sec 4559966 401.00sec
Zipi Zipi melee 0 4950755 12346 18.05 32682 66674 120.7 120.7 24.6% 0.0% 0.0% 0.0% 3.32sec 7278078 401.00sec
Zipi Zipi potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Zipi Zipi potion_of_the_old_war 188028 6020972 15015 4.37 163871 334116 29.2 29.2 24.7% 0.0% 0.0% 0.0% 5.34sec 8851399 401.00sec
Zipi Zipi shield_of_vengeance 184662 0 0 0.57 0 0 3.8 3.8 24.6% 0.0% 0.0% 0.0% 120.00sec 2624346 401.00sec
Zipi Zipi shield_of_vengeance_proc 184689 3918410 9772 0.55 852583 1737970 3.8 3.7 24.6% 0.0% 0.0% 0.0% 119.63sec 3918410 401.00sec
Zipi Zipi templars_verdict 85256 11128191 27751 4.82 275219 561369 32.2 32.2 24.6% 0.0% 0.0% 0.0% 12.57sec 11128191 401.00sec
Zipi Zipi wake_of_ashes 205273 10227978 25506 5.71 213494 435820 13.0 38.1 24.6% 0.0% 0.0% 0.0% 32.24sec 17198071 401.00sec
Zipi Zipi wake_of_ashes ticks -205273 6970093 17425 26.72 31156 63553 13.0 178.1 24.6% 0.0% 0.0% 0.0% 32.24sec 17198071 401.00sec
Zipi Zipi zeal 217020 30456952 75953 44.41 71151 145116 120.4 296.8 42.5% 0.0% 0.0% 0.0% 3.32sec 44774605 401.00sec
Faelik Faelik augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Faelik Faelik deadly_grace 188091 3700035 9227 4.42 96619 193452 29.6 29.5 29.7% 0.0% 0.0% 0.0% 13.99sec 3700035 401.00sec
Faelik Faelik flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Faelik Faelik food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Faelik Faelik mind_blast 8092 11953552 29810 8.59 160617 321403 56.4 57.4 29.6% 0.0% 0.0% 0.0% 7.03sec 11953552 401.00sec
Faelik Faelik mind_flay ticks -15407 6659338 16648 22.89 33639 67402 56.5 152.6 29.6% 0.0% 0.0% 0.0% 7.13sec 6659338 401.00sec
Faelik Faelik mind_sear ticks -48045 16498409 41246 12.40 27331 54669 34.6 82.7 29.7% 0.0% 0.0% 0.0% 8.23sec 16498409 401.00sec
Faelik Faelik potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Faelik Faelik power_infusion 10060 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 122.68sec 0 401.00sec
Faelik Faelik shadow_word_death 32379 1850705 4615 1.14 186750 372923 7.6 7.6 29.9% 0.0% 0.0% 0.0% 10.05sec 1850705 401.00sec
Faelik Faelik shadow_word_pain 589 2424197 6045 7.04 39720 79596 47.0 47.0 29.7% 0.0% 0.0% 0.0% 8.33sec 23532469 401.00sec
Faelik Faelik shadow_word_pain ticks -589 21108273 52771 50.56 48273 96609 47.0 337.0 29.7% 0.0% 0.0% 0.0% 8.33sec 23532469 401.00sec
Faelik Faelik sphere_of_insanity 194182 4916392 12260 54.87 13407 0 276.4 366.7 0.0% 0.0% 0.0% 0.0% 1.39sec 0 401.00sec
Faelik Faelik shadowfiend 34433 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 197.47sec 0 401.00sec
Faelik Faelik shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Faelik Faelik shadowy_apparitions 78203 6641261 16562 26.98 28211 56471 181.8 180.3 30.5% 0.0% 0.0% 0.0% 2.18sec 6641261 401.00sec
Faelik Faelik touch_of_the_grave 127802 1292664 3224 3.78 51136 0 25.3 25.3 0.0% 0.0% 0.0% 0.0% 16.12sec 1292664 401.00sec
Faelik Faelik vampiric_touch ticks -34914 46853025 117133 68.83 78699 157531 39.3 458.9 29.7% 0.0% 0.0% 0.0% 7.79sec 46853025 401.00sec
Faelik Faelik void_bolt 205448 21582114 53821 13.63 182629 365187 91.4 91.1 29.7% 0.0% 0.0% 0.0% 4.19sec 21582114 401.00sec
Faelik Faelik void_eruption 228360 3979706 9925 7.70 59592 119162 10.9 51.5 29.8% 0.0% 0.0% 0.0% 37.20sec 3979706 401.00sec
Faelik Faelik void_torrent ticks -205065 5568581 13921 5.57 115480 230977 6.7 37.1 29.9% 0.0% 0.0% 0.0% 62.24sec 5568581 401.00sec
Faelik Faelik_shadowfiend melee 0 2900166 103851 70.26 68433 136859 32.7 32.7 29.6% 0.0% 0.0% 0.0% 8.76sec 2900166 27.93sec
Faelik Faelik_shadowfiend shadowcrawl 63619 0 0 0.00 0 0 4.7 0.0 0.0% 0.0% 0.0% 0.0% 74.29sec 0 27.93sec
Raji Raji augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Raji Raji berserking 26297 0 0 0.00 0 0 2.6 0.0 0.0% 0.0% 0.0% 0.0% 186.24sec 0 401.00sec
Raji Raji deadly_grace 188091 3732927 9309 4.29 98070 196219 28.7 28.6 32.8% 0.0% 0.0% 0.0% 14.53sec 3732927 401.00sec
Raji Raji flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Raji Raji food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Raji Raji mind_blast 8092 8646092 21561 7.39 131895 263718 48.4 49.4 32.7% 0.0% 0.0% 0.0% 8.21sec 8646092 401.00sec
Raji Raji mind_flay ticks -15407 5409019 13523 18.95 32265 64539 47.7 126.3 32.7% 0.0% 0.0% 0.0% 8.44sec 5409019 401.00sec
Raji Raji mind_sear ticks -48045 15440296 38601 10.66 28717 57439 28.1 71.1 32.7% 0.0% 0.0% 0.0% 10.19sec 15440296 401.00sec
Raji Raji mindbender 200174 0 0 0.00 0 0 7.1 0.0 0.0% 0.0% 0.0% 0.0% 60.47sec 0 401.00sec
Raji Raji potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Raji Raji shadow_word_death 32379 3375141 8417 2.10 181487 363034 14.0 14.0 32.8% 0.0% 0.0% 0.0% 10.16sec 3375141 401.00sec
Raji Raji shadow_word_pain 589 1869518 4662 6.22 33917 67771 41.5 41.5 32.7% 0.0% 0.0% 0.0% 9.40sec 17491932 401.00sec
Raji Raji shadow_word_pain ticks -589 15622414 39056 44.48 39702 79415 41.5 296.5 32.7% 0.0% 0.0% 0.0% 9.40sec 17491932 401.00sec
Raji Raji shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Raji Raji shadowy_apparitions 78203 5876637 14655 24.80 26718 53448 167.2 165.8 32.7% 0.0% 0.0% 0.0% 2.36sec 5876637 401.00sec
Raji Raji vampiric_touch ticks -34914 31849896 79625 53.81 66916 133893 33.9 358.7 32.7% 0.0% 0.0% 0.0% 9.02sec 31849896 401.00sec
Raji Raji void_bolt 205448 19873791 49561 12.13 184681 369415 81.3 81.1 32.7% 0.0% 0.0% 0.0% 4.80sec 19873791 401.00sec
Raji Raji void_eruption 228360 4006966 9993 7.56 59826 119641 11.5 50.5 32.7% 0.0% 0.0% 0.0% 35.43sec 4006966 401.00sec
Raji Raji void_torrent ticks -205065 6117225 15293 6.38 108537 217019 6.9 42.5 32.6% 0.0% 0.0% 0.0% 61.24sec 6117225 401.00sec
Raji Raji volatile_ichor 222187 12545110 31285 11.11 127206 254482 22.0 74.3 32.7% 0.0% 0.0% 0.0% 18.02sec 12545110 401.00sec
Raji Raji_mindbender melee 0 6469958 61556 51.98 53606 107207 91.1 91.1 32.6% 0.0% 0.0% 0.0% 4.27sec 6469958 105.11sec
Raji Raji_mindbender shadowcrawl 63619 0 0 0.00 0 0 21.1 0.0 0.0% 0.0% 0.0% 0.0% 18.93sec 0 105.11sec
Raji Raji_void_tendril mind_flay_void_tendril ticks -193473 1945162 4863 6.94 31708 63416 9.2 46.2 32.7% 0.0% 0.0% 0.0% 40.61sec 1945162 63.86sec
Raji Raji_void_tendril mind_flay_void_tendril ticks -193473 417809 1045 1.49 31708 63416 2.0 9.9 32.7% 0.0% 0.0% 0.0% 61.56sec 417809 13.53sec
Raji Raji_void_tendril mind_flay_void_tendril ticks -193473 321077 803 1.14 31708 63416 1.3 7.6 33.3% 0.0% 0.0% 0.0% 10.47sec 321077 9.73sec
Raji Raji_void_tendril mind_flay_void_tendril ticks -193473 305338 763 1.14 31708 63416 1.3 7.6 26.8% 0.0% 0.0% 0.0% 4.83sec 305338 9.39sec
Vait Vait adrenaline_rush 13750 0 0 0.00 0 0 5.9 0.0 0.0% 0.0% 0.0% 0.0% 71.68sec 0 401.00sec
Vait Vait ambush 8676 1052012 2623 1.05 111671 224087 7.0 7.0 33.9% 0.0% 0.0% 0.0% 64.98sec 1546557 401.00sec
Vait Vait augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Vait Vait auto_attack_mh 0 8118066 20245 38.33 27025 54053 256.2 256.2 36.2% 19.0% 0.0% 0.0% 1.57sec 11934326 401.00sec
Vait Vait auto_attack_oh 1 3767904 9396 35.56 13516 27031 237.6 237.6 36.3% 19.0% 0.0% 0.0% 1.69sec 5539175 401.00sec
Vait Vait blade_flurry 13877 0 0 0.00 0 0 10.0 0.0 0.0% 0.0% 0.0% 0.0% 29.99sec 0 401.00sec
Vait Vait blade_flurry_attack 22482 31980994 79754 311.48 15363 0 416.3 2081.7 0.0% 0.0% 0.0% 0.0% 0.98sec 47015091 401.00sec
Vait Vait curse_of_the_dreadblades 202665 0 0 0.00 0 0 4.8 0.0 0.0% 0.0% 0.0% 0.0% 91.86sec 0 401.00sec
Vait Vait flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Vait Vait food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Vait Vait ghostly_strike 196937 1611579 4019 4.04 43854 87762 27.0 27.0 36.0% 0.0% 0.0% 0.0% 15.05sec 2369174 401.00sec
Vait Vait gouge 1776 0 0 0.00 0 0 19.9 0.0 0.0% 0.0% 0.0% 0.0% 18.18sec 0 401.00sec
Vait Vait greed 202822 13189667 32892 17.40 83171 166359 34.8 116.3 36.4% 0.0% 0.0% 0.0% 11.34sec 19390060 401.00sec
Vait Vait greed_oh 202823 6597570 16453 17.40 41586 83179 34.8 116.3 36.4% 0.0% 0.0% 0.0% 11.34sec 9699053 401.00sec
Vait Vait main_gauche 86392 9589062 23913 36.01 29248 58501 240.7 240.7 36.2% 0.0% 0.0% 0.0% 1.69sec 14096830 401.00sec
Vait Vait marked_for_death 137619 0 0 0.00 0 0 12.7 0.0 0.0% 0.0% 0.0% 0.0% 24.15sec 0 401.00sec
Vait Vait pistol_shot 185763 3037242 7574 6.56 44892 89780 43.8 43.8 54.3% 0.0% 0.0% 0.0% 8.61sec 4465033 401.00sec
Vait Vait potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Vait Vait potion_of_the_old_war 188028 4734316 11806 3.94 131875 264282 26.3 26.3 36.1% 0.0% 0.0% 0.0% 5.49sec 6959893 401.00sec
Vait Vait roll_the_bones 193316 0 0 0.00 0 0 16.3 0.0 0.0% 0.0% 0.0% 0.0% 24.24sec 0 401.00sec
Vait Vait run_through 2098 45666740 113883 14.88 336469 672370 99.5 99.5 36.5% 0.0% 0.0% 0.0% 4.01sec 67134434 401.00sec
Vait Vait saber_slash 193315 23669704 59027 32.46 80093 160200 217.0 217.0 36.2% 0.0% 0.0% 0.0% 1.85sec 34796706 401.00sec
Vait Vait sprint 2983 0 0 0.00 0 0 8.3 0.0 0.0% 0.0% 0.0% 0.0% 49.45sec 0 401.00sec
Vait Vait touch_of_the_grave 127802 1056460 2635 3.61 43756 0 24.1 24.1 0.0% 0.0% 0.0% 0.0% 16.90sec 1056460 401.00sec
Vait Vait vanish 1856 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 64.84sec 0 401.00sec
Bowflexn Bowflexn augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Bowflexn Bowflexn boulderfist 201897 13472607 33598 11.38 135237 276009 76.0 76.0 29.8% 0.0% 0.0% 0.0% 5.29sec 13472607 401.00sec
Bowflexn Bowflexn crash_lightning 187874 15028379 37478 38.47 44579 90946 63.3 257.1 29.9% 0.0% 0.0% 0.0% 6.27sec 15028379 401.00sec
Bowflexn Bowflexn crashing_storm 210801 14906409 37173 246.43 6899 14075 391.9 1647.0 30.0% 0.0% 0.0% 0.0% 1.01sec 14906409 401.00sec
Bowflexn Bowflexn doom_winds 204945 0 0 0.00 0 0 6.8 0.0 0.0% 0.0% 0.0% 0.0% 62.49sec 0 401.00sec
Bowflexn Bowflexn feral_spirit 51533 0 0 0.00 0 0 3.8 0.0 0.0% 0.0% 0.0% 0.0% 120.37sec 0 401.00sec
Bowflexn Bowflexn flametongue 193796 2520434 6285 4.43 65015 132629 29.6 29.6 29.9% 0.0% 0.0% 0.0% 13.65sec 2520434 401.00sec
Bowflexn Bowflexn flametongue_attack 10444 8772259 21876 162.38 6162 12571 1085.2 1085.2 30.0% 0.0% 0.0% 0.0% 1.17sec 8772259 401.00sec
Bowflexn Bowflexn flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Bowflexn Bowflexn food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Bowflexn Bowflexn frostbrand 196834 1607805 4010 3.66 50100 102197 24.5 24.5 30.1% 0.0% 0.0% 0.0% 16.61sec 1607805 401.00sec
Bowflexn Bowflexn hailstorm 210854 21815860 54404 159.31 15622 31870 1064.7 1064.7 30.0% 0.0% 0.0% 0.0% 1.19sec 21815860 401.00sec
Bowflexn Bowflexn lava_lash 60103 2331532 5814 2.37 112596 229628 15.8 15.8 29.8% 0.0% 0.0% 0.0% 24.16sec 2331532 401.00sec
Bowflexn Bowflexn lava_lash_cl 195592 1787188 4457 4.58 44565 90918 7.3 30.6 29.8% 0.0% 0.0% 0.0% 31.78sec 1787188 401.00sec
Bowflexn Bowflexn main_hand 0 3654756 9114 24.52 19886 40581 163.9 163.9 29.9% 19.0% 0.0% 0.0% 2.46sec 5372838 401.00sec
Bowflexn Bowflexn mark_of_the_hidden_satyr 191259 4564642 11383 3.62 144099 294170 24.2 24.2 29.8% 0.0% 0.0% 0.0% 16.45sec 4564642 401.00sec
Bowflexn Bowflexn offhand 1 1822059 4544 24.44 9947 20297 163.3 163.3 29.9% 19.0% 0.0% 0.0% 2.46sec 2678599 401.00sec
Bowflexn Bowflexn potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Bowflexn Bowflexn potion_of_the_old_war 188028 3392735 8461 3.17 122607 250324 21.2 21.2 29.5% 0.0% 0.0% 0.0% 7.41sec 4987643 401.00sec
Bowflexn Bowflexn stormlash 213307 6106736 15229 76.83 11893 0 513.5 513.5 0.0% 0.0% 0.0% 0.0% 1.86sec 6106736 401.00sec
Bowflexn Bowflexn stormstrike 17364 0 0 0.00 0 0 113.6 0.0 0.0% 0.0% 0.0% 0.0% 3.48sec 0 401.00sec
Bowflexn Bowflexn stormstrike_cl 195592 21476685 53558 54.86 44656 91100 82.1 366.6 30.0% 0.0% 0.0% 0.0% 3.57sec 21476685 401.00sec
Bowflexn Bowflexn stormstrike_mh 32175 25859508 64488 21.25 138723 282968 142.0 142.0 30.1% 0.0% 0.0% 0.0% 3.48sec 38015927 401.00sec
Bowflexn Bowflexn stormstrike_offhand 32176 12921162 32223 21.25 69373 141430 142.0 142.0 30.0% 0.0% 0.0% 0.0% 3.48sec 18995332 401.00sec
Bowflexn Bowflexn unleash_lava 199053 3611016 9005 10.43 39475 80521 70.1 69.7 30.0% 0.0% 0.0% 0.0% 8.50sec 3611016 401.00sec
Bowflexn Bowflexn unleash_lightning 199054 3616985 9020 10.45 39475 80525 70.2 69.9 29.9% 0.0% 0.0% 0.0% 8.49sec 3616985 401.00sec
Bowflexn Bowflexn windfury_attack 25504 8522248 21253 41.23 23594 48122 275.5 275.5 29.9% 0.0% 0.0% 0.0% 3.55sec 12528512 401.00sec
Bowflexn Bowflexn windfury_attack_oh 33750 994412 2480 4.20 26974 55027 28.1 28.1 30.0% 0.0% 0.0% 0.0% 27.92sec 1461880 401.00sec
Bowflexn Bowflexn_frost_wolf frozen_bite 224126 1735532 72369 23.68 140949 281896 9.5 9.5 30.1% 0.0% 0.0% 0.0% 35.67sec 1735532 23.98sec
Bowflexn Bowflexn_frost_wolf melee 0 986471 41134 112.54 16864 33737 45.0 45.0 30.0% 0.0% 0.0% 0.0% 6.81sec 1450205 23.98sec
Bowflexn Bowflexn_frost_wolf snowstorm 198483 1938024 80813 99.22 37586 75179 15.4 39.7 30.0% 0.0% 0.0% 0.0% 19.43sec 1938024 23.98sec
Bowflexn Bowflexn_fiery_wolf fiery_jaws 224125 1161416 48412 23.78 93901 187859 9.5 9.5 30.1% 0.0% 0.0% 0.0% 35.62sec 2582372 23.99sec
Bowflexn Bowflexn_fiery_wolf fiery_jaws ticks -224125 1420956 3552 5.67 37567 0 9.5 37.8 0.0% 0.0% 0.0% 0.0% 35.62sec 2582372 23.99sec
Bowflexn Bowflexn_fiery_wolf fire_nova 198480 1953464 81428 100.06 37548 75097 15.5 40.0 30.0% 0.0% 0.0% 0.0% 19.35sec 1953464 23.99sec
Bowflexn Bowflexn_fiery_wolf melee 0 990311 41280 112.93 16864 33737 45.2 45.2 30.0% 0.0% 0.0% 0.0% 6.77sec 1455851 23.99sec
Bowflexn Bowflexn_lightning_wolf crackling_surge 224127 0 0 0.00 0 0 9.6 0.0 0.0% 0.0% 0.0% 0.0% 36.41sec 0 23.55sec
Bowflexn Bowflexn_lightning_wolf melee 0 1423786 60458 118.23 23604 47231 46.4 46.4 29.9% 0.0% 0.0% 0.0% 6.43sec 2093100 23.55sec
Bowflexn Bowflexn_lightning_wolf thunder_bite 198485 2104801 89376 89.26 46250 92425 15.5 35.0 29.9% 0.0% 0.0% 0.0% 19.58sec 2104801 23.55sec
Alacastria Alacastria arcane_torrent 69179 0 0 0.00 0 0 4.9 0.0 0.0% 0.0% 0.0% 0.0% 91.48sec 0 401.00sec
Alacastria Alacastria augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Alacastria Alacastria auto_attack_mh 0 8884811 22157 18.64 56706 115104 124.6 124.6 25.0% 0.0% 0.0% 0.0% 3.25sec 13061514 401.00sec
Alacastria Alacastria avatar 107574 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 90.00sec 0 401.00sec
Alacastria Alacastria battle_cry 1719 0 0 0.00 0 0 13.0 0.0 0.0% 0.0% 0.0% 0.0% 31.98sec 0 401.00sec
Alacastria Alacastria bladestorm 227847 0 0 0.00 0 0 4.4 0.0 0.0% 0.0% 0.0% 0.0% 94.04sec 0 401.00sec
Alacastria Alacastria bladestorm_mh 50622 15178607 37852 25.02 81416 163317 0.0 167.2 11.4% 0.0% 0.0% 0.0% 0.00sec 22313990 401.00sec
Alacastria Alacastria charge 100 0 0 0.00 0 0 12.2 0.0 0.0% 0.0% 0.0% 0.0% 30.80sec 0 401.00sec
Alacastria Alacastria cleansed_drakes_breath 222520 0 0 0.00 0 0 4.1 0.0 0.0% 0.0% 0.0% 0.0% 72.71sec 0 401.00sec
Alacastria Alacastria cleave 845 6612723 16491 24.39 32710 64430 27.2 163.0 24.8% 0.0% 0.0% 0.0% 10.65sec 9721330 401.00sec
Alacastria Alacastria void_cleave 209700 5304599 13229 24.38 26242 51695 27.2 163.0 24.8% 0.0% 0.0% 0.0% 10.66sec 5304599 401.00sec
Alacastria Alacastria colossus_smash 167105 15480510 38605 8.12 232589 451031 54.3 54.3 24.0% 0.0% 0.0% 0.0% 7.48sec 22757817 401.00sec
Alacastria Alacastria corrupted_blood_of_zakajz ticks -209569 13300028 33250 20.94 95292 0 0.0 139.6 0.0% 0.0% 0.0% 0.0% 0.00sec 13300028 401.00sec
Alacastria Alacastria execute 163201 16034088 39986 4.52 371750 811390 30.2 30.2 36.2% 0.0% 0.0% 0.0% 2.38sec 23571628 401.00sec
Alacastria Alacastria flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Alacastria Alacastria focused_rage 207982 0 0 0.00 0 0 166.4 0.0 0.0% 0.0% 0.0% 0.0% 2.36sec 0 401.00sec
Alacastria Alacastria food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Alacastria Alacastria heroic_leap 6544 0 0 0.00 0 0 13.1 0.0 0.0% 0.0% 0.0% 0.0% 31.71sec 0 401.00sec
Alacastria Alacastria mortal_strike 12294 48552145 121079 11.65 380726 897454 77.9 77.9 47.0% 0.0% 0.0% 0.0% 5.02sec 71376252 401.00sec
Alacastria Alacastria potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 401.00sec
Alacastria Alacastria potion_of_the_old_war 188028 8355305 20836 3.29 283454 590484 22.0 22.0 31.3% 0.0% 0.0% 0.0% 17.97sec 12283090 401.00sec
Alacastria Alacastria slam 1464 8740189 21796 6.91 143622 283656 46.2 46.2 32.6% 0.0% 0.0% 0.0% 7.02sec 12848906 401.00sec
Alacastria Alacastria warbreaker 209577 4830183 12045 3.56 166444 341659 6.3 23.8 21.0% 0.0% 0.0% 0.0% 66.22sec 4830183 401.00sec
Alacastria Alacastria whirlwind 1680 0 0 0.00 0 0 24.0 0.0 0.0% 0.0% 0.0% 0.0% 11.67sec 0 401.00sec
Alacastria Alacastria whirlwind_mh 199850 25173531 62777 64.05 46626 88787 72.1 428.1 28.9% 0.0% 0.0% 0.0% 3.79sec 37007475 401.00sec

Fluffy_Pillow : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%
Talents
Scale Factors for Fluffy_Pillow Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking

Scale Factors for other metrics

Scale Factors for Fluffy_Pillow Damage Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Priority Target Damage Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Damage Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_PillowTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 9.38% 9.38% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:9.38%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 9.24% 9.24% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:9.24%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.83% 10.83% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.17% 11.17% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.17%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 11.28% 11.28% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:11.28%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.78% 10.78% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.78%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 10.96% 10.96% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:10.96%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.89% 11.89% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.89%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 9.47% 9.47% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:9.47%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 4.99% 4.99% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:4.99%

Trigger Attempt Success

  • trigger_pct:100.00%
Anguish 7.2 62.7 55.5sec 5.0sec 6.10% 6.10% 0.0(0.0) 7.2

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.31%
  • anguish_2:0.31%
  • anguish_3:0.31%
  • anguish_4:0.31%
  • anguish_5:0.31%
  • anguish_6:0.31%
  • anguish_7:0.30%
  • anguish_8:0.31%
  • anguish_9:0.31%
  • anguish_10:3.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Anguish 11.9 101.9 32.5sec 3.1sec 10.29% 10.29% 0.0(0.0) 11.8

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.61%
  • anguish_2:0.54%
  • anguish_3:0.53%
  • anguish_4:0.53%
  • anguish_5:0.52%
  • anguish_6:0.52%
  • anguish_7:0.52%
  • anguish_8:0.51%
  • anguish_9:0.58%
  • anguish_10:5.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Anguish 7.2 60.5 55.8sec 5.2sec 6.20% 6.20% 0.0(0.0) 7.2

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.37%
  • anguish_2:0.35%
  • anguish_3:0.35%
  • anguish_4:0.35%
  • anguish_5:0.33%
  • anguish_6:0.33%
  • anguish_7:0.32%
  • anguish_8:0.32%
  • anguish_9:0.31%
  • anguish_10:3.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
colossus_smash 17.6 43.0 23.0sec 6.7sec 81.72% 80.01% 43.0(43.0) 16.8

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_colossus_smash
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • colossus_smash_1:81.72%

Trigger Attempt Success

  • trigger_pct:100.00%
Ghostly Strike 5.6 21.4 67.8sec 15.1sec 96.53% 96.89% 103.6(103.6) 4.6

Buff details

  • buff initial source:Vait
  • cooldown name:buff_ghostly_strike
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • ghostly_strike_1:96.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196937
  • name:Ghostly Strike
  • tooltip:Taking $s5% increased damage from the Rogue's abilities.
  • description:Strikes an enemy with your cursed weapon, dealing $sw2 Physical damage and causing the target to take $s5% increased damage from your abilities for {$d=15 seconds}. |cFFFFFFFFAwards $s1 combo $lpoint:points;.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark 36.2 0.0 11.1sec 11.1sec 38.57% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:38.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark 34.1 0.2 11.8sec 11.7sec 26.80% 100.00% 0.2(0.2) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:26.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Judgment 32.9 57.4 12.3sec 4.4sec 84.43% 95.98% 57.4(57.4) 32.0

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_judgment
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • judgment_1:84.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197277
  • name:Judgment
  • tooltip:Taking $w1% increased damage from the Paladin's Holy Power consuming abilities.
  • description:{$@spelldesc20271=Judges the target{$?s218178=false}[ and up to ${$231661s1+$218178s2} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing $s1 Holy damage{$?s76672=false}|a231663[, and causing them to take $197277s1% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by $231657s1 sec, or ${$231657s1*2} sec on a critical strike][].}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Marked for Death 0.5 0.4 100.9sec 7.8sec 7.73% 7.73% 0.4(0.4) 0.5

Buff details

  • buff initial source:Vait
  • cooldown name:buff_marked_for_death
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • marked_for_death_1:7.73%

Trigger Attempt Success

  • trigger_pct:45.41%

Spelldata details

  • id:137619
  • name:Marked for Death
  • tooltip:Marked for Death will reset upon death.
  • description:Marks the target, instantly generating $s1 combo points. Cooldown reset if the target dies within {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:60.00
  • default_chance:0.00%
Nemesis 1.0 0.0 0.0sec 0.0sec 15.18% 18.08% 0.0(0.0) 1.0

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_nemesis
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • nemesis_1:15.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:206491
  • name:Nemesis
  • tooltip:Damage taken increased by $s1%.
  • description:Increases damage you inflict against the target by $s1% for {$d=60 seconds}. When the target is slain, you will inflict $s1% additional damage against all creature types matching the original target (Humanoid, Dragonkin, etc.) for the remaining duration.
  • max_stacks:0
  • duration:60.00
  • cooldown:120.00
  • default_chance:100.00%
Open Wounds 9.1 8.1 36.1sec 19.5sec 77.88% 79.17% 8.1(8.1) 0.8

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_open_wounds
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • open_wounds_1:77.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210670
  • name:Open Wounds
  • tooltip:$s1% of armor is being ignored.
  • description:{$@spelldesc210666=The Fangs of Ashamane tear deep into your target, causing your attacks to ignore $210670s1% of the target's armor while Rip is active.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Stellar Empowerment 15.3 0.0 21.7sec 21.7sec 5.81% 5.31% 0.0(0.0) 15.3

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:1.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:5.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:1.50
  • cooldown:0.00
  • default_chance:0.00%
Vulnerable (vulnerability) 15.5 78.6 25.9sec 4.3sec 91.33% 95.23% 78.6(78.6) 14.5

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:91.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vulnerable (vulnerability) 22.5 69.7 17.9sec 4.4sec 86.52% 87.70% 69.7(69.7) 21.5

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:86.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add1: Anguish 5.1 43.3 0.0sec 0.0sec 8.22% 8.22% 0.0(0.0) 4.7

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.43%
  • anguish_2:0.42%
  • anguish_3:0.41%
  • anguish_4:0.41%
  • anguish_5:0.40%
  • anguish_6:0.41%
  • anguish_7:0.40%
  • anguish_8:0.41%
  • anguish_9:0.40%
  • anguish_10:4.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add1: Anguish 9.7 82.1 0.0sec 0.0sec 16.38% 16.38% 0.0(0.0) 9.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.00%
  • anguish_2:0.86%
  • anguish_3:0.83%
  • anguish_4:0.83%
  • anguish_5:0.81%
  • anguish_6:0.82%
  • anguish_7:0.82%
  • anguish_8:0.81%
  • anguish_9:0.95%
  • anguish_10:8.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add1: Anguish 5.3 42.6 0.0sec 0.0sec 8.56% 8.56% 0.0(0.0) 4.9

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.53%
  • anguish_2:0.48%
  • anguish_3:0.48%
  • anguish_4:0.48%
  • anguish_5:0.44%
  • anguish_6:0.43%
  • anguish_7:0.42%
  • anguish_8:0.42%
  • anguish_9:0.41%
  • anguish_10:4.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add1: bleeding 10.0 0.0 0.0sec 0.0sec 97.61% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add1
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:97.61%
Add1: colossus_smash 3.5 0.0 0.0sec 0.0sec 11.36% 9.62% 0.0(0.0) 2.3

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_colossus_smash
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • colossus_smash_1:11.36%

Trigger Attempt Success

  • trigger_pct:99.27%
Add1: Hunter's Mark 17.3 0.0 0.0sec 0.0sec 30.79% 73.53% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:30.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add1: Hunter's Mark 16.2 0.0 0.0sec 0.0sec 13.70% 77.72% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add1: Judgment 18.6 4.4 0.0sec 0.0sec 69.06% 85.35% 4.4(4.4) 9.6

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_judgment
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • judgment_1:69.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197277
  • name:Judgment
  • tooltip:Taking $w1% increased damage from the Paladin's Holy Power consuming abilities.
  • description:{$@spelldesc20271=Judges the target{$?s218178=false}[ and up to ${$231661s1+$218178s2} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing $s1 Holy damage{$?s76672=false}|a231663[, and causing them to take $197277s1% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by $231657s1 sec, or ${$231657s1*2} sec on a critical strike][].}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Add1: Marked for Death 9.9 2.0 0.0sec 0.0sec 40.68% 40.68% 2.0(2.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_marked_for_death
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • marked_for_death_1:40.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:137619
  • name:Marked for Death
  • tooltip:Marked for Death will reset upon death.
  • description:Marks the target, instantly generating $s1 combo points. Cooldown reset if the target dies within {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:60.00
  • default_chance:0.00%
Add1: Nemesis 2.0 0.0 0.0sec 0.0sec 9.34% 11.38% 0.0(0.0) 0.0

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_nemesis
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • nemesis_1:9.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:206491
  • name:Nemesis
  • tooltip:Damage taken increased by $s1%.
  • description:Increases damage you inflict against the target by $s1% for {$d=60 seconds}. When the target is slain, you will inflict $s1% additional damage against all creature types matching the original target (Humanoid, Dragonkin, etc.) for the remaining duration.
  • max_stacks:0
  • duration:60.00
  • cooldown:120.00
  • default_chance:100.00%
Add1: Open Wounds 5.8 0.0 0.0sec 0.0sec 34.95% 63.42% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_open_wounds
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • open_wounds_1:34.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210670
  • name:Open Wounds
  • tooltip:$s1% of armor is being ignored.
  • description:{$@spelldesc210666=The Fangs of Ashamane tear deep into your target, causing your attacks to ignore $210670s1% of the target's armor while Rip is active.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Add1: Stellar Empowerment 13.0 0.0 0.0sec 0.0sec 9.37% 11.75% 0.0(0.0) 12.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:1.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:9.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:1.50
  • cooldown:0.00
  • default_chance:0.00%
Add1: Vulnerable (vulnerability) 14.4 18.3 0.0sec 0.0sec 62.92% 68.84% 18.3(18.3) 6.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:62.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add1: Vulnerable (vulnerability) 16.9 18.2 0.0sec 0.0sec 59.36% 77.64% 18.2(18.2) 9.8

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:59.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add2: Anguish 5.1 43.3 0.0sec 0.0sec 8.22% 8.22% 0.0(0.0) 4.7

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.43%
  • anguish_2:0.42%
  • anguish_3:0.41%
  • anguish_4:0.41%
  • anguish_5:0.40%
  • anguish_6:0.41%
  • anguish_7:0.40%
  • anguish_8:0.41%
  • anguish_9:0.40%
  • anguish_10:4.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add2: Anguish 9.7 82.1 0.0sec 0.0sec 16.38% 16.38% 0.0(0.0) 9.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.00%
  • anguish_2:0.86%
  • anguish_3:0.83%
  • anguish_4:0.83%
  • anguish_5:0.81%
  • anguish_6:0.82%
  • anguish_7:0.82%
  • anguish_8:0.81%
  • anguish_9:0.95%
  • anguish_10:8.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add2: Anguish 5.3 42.6 0.0sec 0.0sec 8.56% 8.56% 0.0(0.0) 4.9

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.53%
  • anguish_2:0.48%
  • anguish_3:0.48%
  • anguish_4:0.48%
  • anguish_5:0.44%
  • anguish_6:0.43%
  • anguish_7:0.42%
  • anguish_8:0.42%
  • anguish_9:0.41%
  • anguish_10:4.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add2: bleeding 10.0 0.0 0.0sec 0.0sec 97.61% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:97.61%
Add2: colossus_smash 3.5 0.0 0.0sec 0.0sec 11.36% 9.62% 0.0(0.0) 2.3

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_colossus_smash
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • colossus_smash_1:11.36%

Trigger Attempt Success

  • trigger_pct:99.27%
Add2: Hunter's Mark 17.3 0.0 0.0sec 0.0sec 30.79% 73.53% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:30.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add2: Hunter's Mark 16.2 0.0 0.0sec 0.0sec 13.70% 77.72% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add2: Open Wounds 0.5 0.0 0.1sec 0.0sec 1.48% 4.19% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_open_wounds
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • open_wounds_1:1.48%

Trigger Attempt Success

  • trigger_pct:35.42%

Spelldata details

  • id:210670
  • name:Open Wounds
  • tooltip:$s1% of armor is being ignored.
  • description:{$@spelldesc210666=The Fangs of Ashamane tear deep into your target, causing your attacks to ignore $210670s1% of the target's armor while Rip is active.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Add2: Stellar Empowerment 13.0 0.0 0.0sec 0.0sec 9.37% 11.75% 0.0(0.0) 12.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:1.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:9.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:1.50
  • cooldown:0.00
  • default_chance:0.00%
Add2: Vulnerable (vulnerability) 14.4 18.3 0.0sec 0.0sec 62.92% 68.84% 18.3(18.3) 6.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:62.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add2: Vulnerable (vulnerability) 16.9 18.2 0.0sec 0.0sec 59.36% 77.64% 18.2(18.2) 9.8

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:59.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add3: Anguish 5.1 43.3 0.0sec 0.0sec 8.22% 8.22% 0.0(0.0) 4.7

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.43%
  • anguish_2:0.42%
  • anguish_3:0.41%
  • anguish_4:0.41%
  • anguish_5:0.40%
  • anguish_6:0.41%
  • anguish_7:0.40%
  • anguish_8:0.41%
  • anguish_9:0.40%
  • anguish_10:4.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add3: Anguish 9.7 82.1 0.0sec 0.0sec 16.38% 16.38% 0.0(0.0) 9.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.00%
  • anguish_2:0.86%
  • anguish_3:0.83%
  • anguish_4:0.83%
  • anguish_5:0.81%
  • anguish_6:0.82%
  • anguish_7:0.82%
  • anguish_8:0.81%
  • anguish_9:0.95%
  • anguish_10:8.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add3: Anguish 5.3 42.6 0.0sec 0.0sec 8.56% 8.56% 0.0(0.0) 4.9

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.53%
  • anguish_2:0.48%
  • anguish_3:0.48%
  • anguish_4:0.48%
  • anguish_5:0.44%
  • anguish_6:0.43%
  • anguish_7:0.42%
  • anguish_8:0.42%
  • anguish_9:0.41%
  • anguish_10:4.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add3: bleeding 12.7 0.0 0.0sec 0.0sec 90.06% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add3
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:90.06%
Add3: colossus_smash 3.5 0.0 0.0sec 0.0sec 11.36% 9.62% 0.0(0.0) 2.3

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_colossus_smash
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • colossus_smash_1:11.36%

Trigger Attempt Success

  • trigger_pct:99.27%
Add3: Hunter's Mark 17.3 0.0 0.0sec 0.0sec 30.79% 73.53% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:30.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add3: Hunter's Mark 16.2 0.0 0.0sec 0.0sec 13.70% 77.72% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add3: Open Wounds 0.0 0.0 215.7sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_open_wounds
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • open_wounds_1:0.00%

Trigger Attempt Success

  • trigger_pct:0.01%

Spelldata details

  • id:210670
  • name:Open Wounds
  • tooltip:$s1% of armor is being ignored.
  • description:{$@spelldesc210666=The Fangs of Ashamane tear deep into your target, causing your attacks to ignore $210670s1% of the target's armor while Rip is active.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Add3: Stellar Empowerment 13.0 0.0 0.0sec 0.0sec 9.37% 11.75% 0.0(0.0) 12.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:1.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:9.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:1.50
  • cooldown:0.00
  • default_chance:0.00%
Add3: Vulnerable (vulnerability) 14.4 18.3 0.0sec 0.0sec 62.92% 68.84% 18.3(18.3) 6.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:62.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add3: Vulnerable (vulnerability) 16.9 18.2 0.0sec 0.0sec 59.36% 77.64% 18.2(18.2) 9.8

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:59.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add4: Anguish 5.1 43.3 0.0sec 0.0sec 8.22% 8.22% 0.0(0.0) 4.7

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.43%
  • anguish_2:0.42%
  • anguish_3:0.41%
  • anguish_4:0.41%
  • anguish_5:0.40%
  • anguish_6:0.41%
  • anguish_7:0.40%
  • anguish_8:0.41%
  • anguish_9:0.40%
  • anguish_10:4.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add4: Anguish 9.7 82.1 0.0sec 0.0sec 16.38% 16.38% 0.0(0.0) 9.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.00%
  • anguish_2:0.86%
  • anguish_3:0.83%
  • anguish_4:0.83%
  • anguish_5:0.81%
  • anguish_6:0.82%
  • anguish_7:0.82%
  • anguish_8:0.81%
  • anguish_9:0.95%
  • anguish_10:8.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add4: Anguish 5.3 42.6 0.0sec 0.0sec 8.56% 8.56% 0.0(0.0) 4.9

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.53%
  • anguish_2:0.48%
  • anguish_3:0.48%
  • anguish_4:0.48%
  • anguish_5:0.44%
  • anguish_6:0.43%
  • anguish_7:0.42%
  • anguish_8:0.42%
  • anguish_9:0.41%
  • anguish_10:4.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add4: bleeding 12.7 0.0 0.0sec 0.0sec 90.06% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add4
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:90.06%
Add4: colossus_smash 3.5 0.0 0.0sec 0.0sec 11.36% 9.62% 0.0(0.0) 2.3

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_colossus_smash
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • colossus_smash_1:11.36%

Trigger Attempt Success

  • trigger_pct:99.27%
Add4: Hunter's Mark 17.3 0.0 0.0sec 0.0sec 30.79% 73.53% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:30.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add4: Hunter's Mark 16.2 0.0 0.0sec 0.0sec 13.70% 77.72% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add4: Stellar Empowerment 13.0 0.0 0.0sec 0.0sec 9.37% 11.75% 0.0(0.0) 12.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:1.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:9.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:1.50
  • cooldown:0.00
  • default_chance:0.00%
Add4: Vulnerable (vulnerability) 14.4 18.3 0.0sec 0.0sec 62.92% 68.84% 18.3(18.3) 6.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:62.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add4: Vulnerable (vulnerability) 16.9 18.2 0.0sec 0.0sec 59.36% 77.64% 18.2(18.2) 9.8

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:59.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add5: Anguish 5.1 43.3 0.0sec 0.0sec 8.22% 8.22% 0.0(0.0) 4.7

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.43%
  • anguish_2:0.42%
  • anguish_3:0.41%
  • anguish_4:0.41%
  • anguish_5:0.40%
  • anguish_6:0.41%
  • anguish_7:0.40%
  • anguish_8:0.41%
  • anguish_9:0.40%
  • anguish_10:4.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add5: Anguish 9.7 82.1 0.0sec 0.0sec 16.38% 16.38% 0.0(0.0) 9.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.00%
  • anguish_2:0.86%
  • anguish_3:0.83%
  • anguish_4:0.83%
  • anguish_5:0.81%
  • anguish_6:0.82%
  • anguish_7:0.82%
  • anguish_8:0.81%
  • anguish_9:0.95%
  • anguish_10:8.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add5: Anguish 5.3 42.6 0.0sec 0.0sec 8.56% 8.56% 0.0(0.0) 4.9

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.53%
  • anguish_2:0.48%
  • anguish_3:0.48%
  • anguish_4:0.48%
  • anguish_5:0.44%
  • anguish_6:0.43%
  • anguish_7:0.42%
  • anguish_8:0.42%
  • anguish_9:0.41%
  • anguish_10:4.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add5: bleeding 12.7 0.0 0.0sec 0.0sec 90.06% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add5
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:90.06%
Add5: colossus_smash 3.5 0.0 0.0sec 0.0sec 11.36% 9.62% 0.0(0.0) 2.3

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_colossus_smash
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • colossus_smash_1:11.36%

Trigger Attempt Success

  • trigger_pct:99.27%
Add5: Hunter's Mark 17.3 0.0 0.0sec 0.0sec 30.79% 73.53% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:30.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add5: Hunter's Mark 16.2 0.0 0.0sec 0.0sec 13.70% 77.72% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add5: Stellar Empowerment 13.0 0.0 0.0sec 0.0sec 9.37% 11.75% 0.0(0.0) 12.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:1.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:9.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:1.50
  • cooldown:0.00
  • default_chance:0.00%
Add5: Vulnerable (vulnerability) 14.4 18.3 0.0sec 0.0sec 62.92% 68.84% 18.3(18.3) 6.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:62.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add5: Vulnerable (vulnerability) 16.9 18.2 0.0sec 0.0sec 59.36% 77.64% 18.2(18.2) 9.8

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:59.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:95.80%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 3216263.68
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Deaths

death count 12603
death count pct 125.99
avg death time 400.41
min death time 308.02
max death time 501.87
dmg taken 1289848232.43

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 9999
Mean 401.00
Minimum 308.02
Maximum 501.87
Spread ( max - min ) 193.85
Range [ ( max - min ) / 2 * 100% ] 24.17%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 9999
Mean 3218673.18
Minimum 3062639.40
Maximum 3365890.59
Spread ( max - min ) 303251.19
Range [ ( max - min ) / 2 * 100% ] 4.71%
Standard Deviation 39424.0960
5th Percentile 3154993.85
95th Percentile 3284167.74
( 95th Percentile - 5th Percentile ) 129173.88
Mean Distribution
Standard Deviation 394.2607
95.00% Confidence Intervall ( 3217900.44 - 3219445.92 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 5
0.1% Error 576
0.1 Scale Factor Error with Delta=300 13268051
0.05 Scale Factor Error with Delta=300 53072206
0.01 Scale Factor Error with Delta=300 1326805171
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 1545177634 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 3474
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
level=113
race=humanoid
role=tank
position=front
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

Fluffy_Pillow_Add1 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Add1: Anguish 5.1 43.3 0.0sec 0.0sec 8.22% 8.22% 0.0(0.0) 4.7

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.43%
  • anguish_2:0.42%
  • anguish_3:0.41%
  • anguish_4:0.41%
  • anguish_5:0.40%
  • anguish_6:0.41%
  • anguish_7:0.40%
  • anguish_8:0.41%
  • anguish_9:0.40%
  • anguish_10:4.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add1: Anguish 9.7 82.1 0.0sec 0.0sec 16.38% 16.38% 0.0(0.0) 9.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.00%
  • anguish_2:0.86%
  • anguish_3:0.83%
  • anguish_4:0.83%
  • anguish_5:0.81%
  • anguish_6:0.82%
  • anguish_7:0.82%
  • anguish_8:0.81%
  • anguish_9:0.95%
  • anguish_10:8.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add1: Anguish 5.3 42.6 0.0sec 0.0sec 8.56% 8.56% 0.0(0.0) 4.9

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.53%
  • anguish_2:0.48%
  • anguish_3:0.48%
  • anguish_4:0.48%
  • anguish_5:0.44%
  • anguish_6:0.43%
  • anguish_7:0.42%
  • anguish_8:0.42%
  • anguish_9:0.41%
  • anguish_10:4.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add1: bleeding 10.0 0.0 0.0sec 0.0sec 97.61% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add1
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:97.61%
Add1: colossus_smash 3.5 0.0 0.0sec 0.0sec 11.36% 9.62% 0.0(0.0) 2.3

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_colossus_smash
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • colossus_smash_1:11.36%

Trigger Attempt Success

  • trigger_pct:99.27%
Add1: Hunter's Mark 17.3 0.0 0.0sec 0.0sec 30.79% 73.53% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:30.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add1: Hunter's Mark 16.2 0.0 0.0sec 0.0sec 13.70% 77.72% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add1: Judgment 18.6 4.4 0.0sec 0.0sec 69.06% 85.35% 4.4(4.4) 9.6

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_judgment
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • judgment_1:69.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197277
  • name:Judgment
  • tooltip:Taking $w1% increased damage from the Paladin's Holy Power consuming abilities.
  • description:{$@spelldesc20271=Judges the target{$?s218178=false}[ and up to ${$231661s1+$218178s2} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing $s1 Holy damage{$?s76672=false}|a231663[, and causing them to take $197277s1% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by $231657s1 sec, or ${$231657s1*2} sec on a critical strike][].}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Add1: Marked for Death 9.9 2.0 0.0sec 0.0sec 40.68% 40.68% 2.0(2.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_marked_for_death
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • marked_for_death_1:40.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:137619
  • name:Marked for Death
  • tooltip:Marked for Death will reset upon death.
  • description:Marks the target, instantly generating $s1 combo points. Cooldown reset if the target dies within {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:60.00
  • default_chance:0.00%
Add1: Nemesis 2.0 0.0 0.0sec 0.0sec 9.34% 11.38% 0.0(0.0) 0.0

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_nemesis
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • nemesis_1:9.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:206491
  • name:Nemesis
  • tooltip:Damage taken increased by $s1%.
  • description:Increases damage you inflict against the target by $s1% for {$d=60 seconds}. When the target is slain, you will inflict $s1% additional damage against all creature types matching the original target (Humanoid, Dragonkin, etc.) for the remaining duration.
  • max_stacks:0
  • duration:60.00
  • cooldown:120.00
  • default_chance:100.00%
Add1: Open Wounds 5.8 0.0 0.0sec 0.0sec 34.95% 63.42% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_open_wounds
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • open_wounds_1:34.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210670
  • name:Open Wounds
  • tooltip:$s1% of armor is being ignored.
  • description:{$@spelldesc210666=The Fangs of Ashamane tear deep into your target, causing your attacks to ignore $210670s1% of the target's armor while Rip is active.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Add1: Stellar Empowerment 13.0 0.0 0.0sec 0.0sec 9.37% 11.75% 0.0(0.0) 12.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:1.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:9.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:1.50
  • cooldown:0.00
  • default_chance:0.00%
Add1: Vulnerable (vulnerability) 14.4 18.3 0.0sec 0.0sec 62.92% 68.84% 18.3(18.3) 6.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:62.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add1: Vulnerable (vulnerability) 16.9 18.2 0.0sec 0.0sec 59.36% 77.64% 18.2(18.2) 9.8

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:59.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add1
Resource RPS-Gain RPS-Loss
Health 0.00 1008756.50
Combat End Resource Mean Min Max
Health 1270771418.70 1010324188.72 1526286116.01

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add1 Fight Length
Count 9999
Mean 200.00
Minimum 198.02
Maximum 200.00
Spread ( max - min ) 1.98
Range [ ( max - min ) / 2 * 100% ] 0.50%
DPS
Sample Data Add1 Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Add1 Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Add1 Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add1 Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add1 Damage Taken Per Second
Count 9999
Mean 1008756.51
Minimum 941910.34
Maximum 1082866.08
Spread ( max - min ) 140955.74
Range [ ( max - min ) / 2 * 100% ] 6.99%
HPS
Sample Data Add1 Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Add1 Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add1 Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add1 Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add1 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Add1Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Add1 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 1545151881 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Add1"
level=113
race=none
role=auto
position=back
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Add2 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Add2: Anguish 5.1 43.3 0.0sec 0.0sec 8.22% 8.22% 0.0(0.0) 4.7

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.43%
  • anguish_2:0.42%
  • anguish_3:0.41%
  • anguish_4:0.41%
  • anguish_5:0.40%
  • anguish_6:0.41%
  • anguish_7:0.40%
  • anguish_8:0.41%
  • anguish_9:0.40%
  • anguish_10:4.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add2: Anguish 9.7 82.1 0.0sec 0.0sec 16.38% 16.38% 0.0(0.0) 9.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.00%
  • anguish_2:0.86%
  • anguish_3:0.83%
  • anguish_4:0.83%
  • anguish_5:0.81%
  • anguish_6:0.82%
  • anguish_7:0.82%
  • anguish_8:0.81%
  • anguish_9:0.95%
  • anguish_10:8.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add2: Anguish 5.3 42.6 0.0sec 0.0sec 8.56% 8.56% 0.0(0.0) 4.9

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.53%
  • anguish_2:0.48%
  • anguish_3:0.48%
  • anguish_4:0.48%
  • anguish_5:0.44%
  • anguish_6:0.43%
  • anguish_7:0.42%
  • anguish_8:0.42%
  • anguish_9:0.41%
  • anguish_10:4.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add2: bleeding 10.0 0.0 0.0sec 0.0sec 97.61% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:97.61%
Add2: colossus_smash 3.5 0.0 0.0sec 0.0sec 11.36% 9.62% 0.0(0.0) 2.3

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_colossus_smash
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • colossus_smash_1:11.36%

Trigger Attempt Success

  • trigger_pct:99.27%
Add2: Hunter's Mark 17.3 0.0 0.0sec 0.0sec 30.79% 73.53% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:30.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add2: Hunter's Mark 16.2 0.0 0.0sec 0.0sec 13.70% 77.72% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add2: Open Wounds 0.5 0.0 0.1sec 0.0sec 1.48% 4.19% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_open_wounds
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • open_wounds_1:1.48%

Trigger Attempt Success

  • trigger_pct:35.42%

Spelldata details

  • id:210670
  • name:Open Wounds
  • tooltip:$s1% of armor is being ignored.
  • description:{$@spelldesc210666=The Fangs of Ashamane tear deep into your target, causing your attacks to ignore $210670s1% of the target's armor while Rip is active.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Add2: Stellar Empowerment 13.0 0.0 0.0sec 0.0sec 9.37% 11.75% 0.0(0.0) 12.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:1.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:9.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:1.50
  • cooldown:0.00
  • default_chance:0.00%
Add2: Vulnerable (vulnerability) 14.4 18.3 0.0sec 0.0sec 62.92% 68.84% 18.3(18.3) 6.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:62.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add2: Vulnerable (vulnerability) 16.9 18.2 0.0sec 0.0sec 59.36% 77.64% 18.2(18.2) 9.8

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:59.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add2
Resource RPS-Gain RPS-Loss
Health 0.00 927686.54
Combat End Resource Mean Min Max
Health 1271914355.42 1010586207.59 1527283668.68

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add2 Fight Length
Count 9999
Mean 200.00
Minimum 198.02
Maximum 200.00
Spread ( max - min ) 1.98
Range [ ( max - min ) / 2 * 100% ] 0.50%
DPS
Sample Data Add2 Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Add2 Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Add2 Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add2 Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add2 Damage Taken Per Second
Count 9999
Mean 927686.58
Minimum 866809.30
Maximum 999928.76
Spread ( max - min ) 133119.46
Range [ ( max - min ) / 2 * 100% ] 7.17%
HPS
Sample Data Add2 Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Add2 Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add2 Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add2 Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add2 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Add2Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Add2 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 1545151881 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Add2"
level=113
race=none
role=auto
position=back
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Add3 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Add3: Anguish 5.1 43.3 0.0sec 0.0sec 8.22% 8.22% 0.0(0.0) 4.7

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.43%
  • anguish_2:0.42%
  • anguish_3:0.41%
  • anguish_4:0.41%
  • anguish_5:0.40%
  • anguish_6:0.41%
  • anguish_7:0.40%
  • anguish_8:0.41%
  • anguish_9:0.40%
  • anguish_10:4.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add3: Anguish 9.7 82.1 0.0sec 0.0sec 16.38% 16.38% 0.0(0.0) 9.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.00%
  • anguish_2:0.86%
  • anguish_3:0.83%
  • anguish_4:0.83%
  • anguish_5:0.81%
  • anguish_6:0.82%
  • anguish_7:0.82%
  • anguish_8:0.81%
  • anguish_9:0.95%
  • anguish_10:8.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add3: Anguish 5.3 42.6 0.0sec 0.0sec 8.56% 8.56% 0.0(0.0) 4.9

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.53%
  • anguish_2:0.48%
  • anguish_3:0.48%
  • anguish_4:0.48%
  • anguish_5:0.44%
  • anguish_6:0.43%
  • anguish_7:0.42%
  • anguish_8:0.42%
  • anguish_9:0.41%
  • anguish_10:4.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add3: bleeding 12.7 0.0 0.0sec 0.0sec 90.06% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add3
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:90.06%
Add3: colossus_smash 3.5 0.0 0.0sec 0.0sec 11.36% 9.62% 0.0(0.0) 2.3

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_colossus_smash
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • colossus_smash_1:11.36%

Trigger Attempt Success

  • trigger_pct:99.27%
Add3: Hunter's Mark 17.3 0.0 0.0sec 0.0sec 30.79% 73.53% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:30.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add3: Hunter's Mark 16.2 0.0 0.0sec 0.0sec 13.70% 77.72% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add3: Open Wounds 0.0 0.0 215.7sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_open_wounds
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • open_wounds_1:0.00%

Trigger Attempt Success

  • trigger_pct:0.01%

Spelldata details

  • id:210670
  • name:Open Wounds
  • tooltip:$s1% of armor is being ignored.
  • description:{$@spelldesc210666=The Fangs of Ashamane tear deep into your target, causing your attacks to ignore $210670s1% of the target's armor while Rip is active.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Add3: Stellar Empowerment 13.0 0.0 0.0sec 0.0sec 9.37% 11.75% 0.0(0.0) 12.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:1.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:9.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:1.50
  • cooldown:0.00
  • default_chance:0.00%
Add3: Vulnerable (vulnerability) 14.4 18.3 0.0sec 0.0sec 62.92% 68.84% 18.3(18.3) 6.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:62.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add3: Vulnerable (vulnerability) 16.9 18.2 0.0sec 0.0sec 59.36% 77.64% 18.2(18.2) 9.8

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:59.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add3
Resource RPS-Gain RPS-Loss
Health 0.00 773111.34
Combat End Resource Mean Min Max
Health 1275068623.51 1013923894.05 1531077405.84

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add3 Fight Length
Count 9999
Mean 200.00
Minimum 198.02
Maximum 200.00
Spread ( max - min ) 1.98
Range [ ( max - min ) / 2 * 100% ] 0.50%
DPS
Sample Data Add3 Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Add3 Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Add3 Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add3 Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add3 Damage Taken Per Second
Count 9999
Mean 773111.37
Minimum 717115.63
Maximum 832347.21
Spread ( max - min ) 115231.59
Range [ ( max - min ) / 2 * 100% ] 7.45%
HPS
Sample Data Add3 Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Add3 Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add3 Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add3 Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add3 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Add3Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Add3 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 1545151881 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Add3"
level=113
race=none
role=auto
position=back
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Add4 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Add4: Anguish 5.1 43.3 0.0sec 0.0sec 8.22% 8.22% 0.0(0.0) 4.7

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.43%
  • anguish_2:0.42%
  • anguish_3:0.41%
  • anguish_4:0.41%
  • anguish_5:0.40%
  • anguish_6:0.41%
  • anguish_7:0.40%
  • anguish_8:0.41%
  • anguish_9:0.40%
  • anguish_10:4.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add4: Anguish 9.7 82.1 0.0sec 0.0sec 16.38% 16.38% 0.0(0.0) 9.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.00%
  • anguish_2:0.86%
  • anguish_3:0.83%
  • anguish_4:0.83%
  • anguish_5:0.81%
  • anguish_6:0.82%
  • anguish_7:0.82%
  • anguish_8:0.81%
  • anguish_9:0.95%
  • anguish_10:8.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add4: Anguish 5.3 42.6 0.0sec 0.0sec 8.56% 8.56% 0.0(0.0) 4.9

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.53%
  • anguish_2:0.48%
  • anguish_3:0.48%
  • anguish_4:0.48%
  • anguish_5:0.44%
  • anguish_6:0.43%
  • anguish_7:0.42%
  • anguish_8:0.42%
  • anguish_9:0.41%
  • anguish_10:4.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add4: bleeding 12.7 0.0 0.0sec 0.0sec 90.06% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add4
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:90.06%
Add4: colossus_smash 3.5 0.0 0.0sec 0.0sec 11.36% 9.62% 0.0(0.0) 2.3

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_colossus_smash
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • colossus_smash_1:11.36%

Trigger Attempt Success

  • trigger_pct:99.27%
Add4: Hunter's Mark 17.3 0.0 0.0sec 0.0sec 30.79% 73.53% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:30.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add4: Hunter's Mark 16.2 0.0 0.0sec 0.0sec 13.70% 77.72% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add4: Stellar Empowerment 13.0 0.0 0.0sec 0.0sec 9.37% 11.75% 0.0(0.0) 12.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:1.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:9.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:1.50
  • cooldown:0.00
  • default_chance:0.00%
Add4: Vulnerable (vulnerability) 14.4 18.3 0.0sec 0.0sec 62.92% 68.84% 18.3(18.3) 6.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:62.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add4: Vulnerable (vulnerability) 16.9 18.2 0.0sec 0.0sec 59.36% 77.64% 18.2(18.2) 9.8

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:59.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add4
Resource RPS-Gain RPS-Loss
Health 0.00 759587.34
Combat End Resource Mean Min Max
Health 1275353768.10 1014827827.97 1531175907.26

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add4 Fight Length
Count 9999
Mean 200.00
Minimum 198.02
Maximum 200.00
Spread ( max - min ) 1.98
Range [ ( max - min ) / 2 * 100% ] 0.50%
DPS
Sample Data Add4 Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Add4 Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Add4 Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add4 Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add4 Damage Taken Per Second
Count 9999
Mean 759587.39
Minimum 690558.36
Maximum 838876.48
Spread ( max - min ) 148318.12
Range [ ( max - min ) / 2 * 100% ] 9.76%
HPS
Sample Data Add4 Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Add4 Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add4 Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add4 Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add4 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Add4Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Add4 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 1545151881 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Add4"
level=113
race=none
role=auto
position=back
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Add5 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Add5: Anguish 5.1 43.3 0.0sec 0.0sec 8.22% 8.22% 0.0(0.0) 4.7

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.43%
  • anguish_2:0.42%
  • anguish_3:0.41%
  • anguish_4:0.41%
  • anguish_5:0.40%
  • anguish_6:0.41%
  • anguish_7:0.40%
  • anguish_8:0.41%
  • anguish_9:0.40%
  • anguish_10:4.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add5: Anguish 9.7 82.1 0.0sec 0.0sec 16.38% 16.38% 0.0(0.0) 9.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.00%
  • anguish_2:0.86%
  • anguish_3:0.83%
  • anguish_4:0.83%
  • anguish_5:0.81%
  • anguish_6:0.82%
  • anguish_7:0.82%
  • anguish_8:0.81%
  • anguish_9:0.95%
  • anguish_10:8.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add5: Anguish 5.3 42.6 0.0sec 0.0sec 8.56% 8.56% 0.0(0.0) 4.9

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.53%
  • anguish_2:0.48%
  • anguish_3:0.48%
  • anguish_4:0.48%
  • anguish_5:0.44%
  • anguish_6:0.43%
  • anguish_7:0.42%
  • anguish_8:0.42%
  • anguish_9:0.41%
  • anguish_10:4.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add5: bleeding 12.7 0.0 0.0sec 0.0sec 90.06% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add5
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:90.06%
Add5: colossus_smash 3.5 0.0 0.0sec 0.0sec 11.36% 9.62% 0.0(0.0) 2.3

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_colossus_smash
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • colossus_smash_1:11.36%

Trigger Attempt Success

  • trigger_pct:99.27%
Add5: Hunter's Mark 17.3 0.0 0.0sec 0.0sec 30.79% 73.53% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:30.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add5: Hunter's Mark 16.2 0.0 0.0sec 0.0sec 13.70% 77.72% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add5: Stellar Empowerment 13.0 0.0 0.0sec 0.0sec 9.37% 11.75% 0.0(0.0) 12.0

Buff details

  • buff initial source:Buuey
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:1.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:9.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:1.50
  • cooldown:0.00
  • default_chance:0.00%
Add5: Vulnerable (vulnerability) 14.4 18.3 0.0sec 0.0sec 62.92% 68.84% 18.3(18.3) 6.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:62.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add5: Vulnerable (vulnerability) 16.9 18.2 0.0sec 0.0sec 59.36% 77.64% 18.2(18.2) 9.8

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:59.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add5
Resource RPS-Gain RPS-Loss
Health 0.00 771759.16
Combat End Resource Mean Min Max
Health 1275197398.22 1012822398.44 1531395380.40

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add5 Fight Length
Count 9999
Mean 200.00
Minimum 198.02
Maximum 200.00
Spread ( max - min ) 1.98
Range [ ( max - min ) / 2 * 100% ] 0.50%
DPS
Sample Data Add5 Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Add5 Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Add5 Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add5 Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add5 Damage Taken Per Second
Count 9999
Mean 771759.15
Minimum 707566.59
Maximum 850205.05
Spread ( max - min ) 142638.45
Range [ ( max - min ) / 2 * 100% ] 9.24%
HPS
Sample Data Add5 Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Add5 Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add5 Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add5 Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add5 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Add5Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Add5 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 1545151881 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Add5"
level=113
race=none
role=auto
position=back
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 400.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.